SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|167629876|ref|YP_001680375.1| from Heliobacterium modesticaldum Ice1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|167629876|ref|YP_001680375.1|
Domain Number 1 Region: 24-97
Classification Level Classification E-value
Superfamily Cell division protein ZapA-like 1.96e-16
Family Cell division protein ZapA-like 0.0025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|167629876|ref|YP_001680375.1|
Sequence length 102
Comment hypothetical protein HM1_1799 [Heliobacterium modesticaldum Ice1]
Sequence
MEDSSSAVVVEGEPSVPEEVHKTTVHIYGEPYTIRSPLTSQQMKQLAATVDERMQEISRK
GPHLSVSKVAVMAALHFAHDLAKLQEDYDDLIKLLEDSSSPK
Download sequence
Identical sequences B0TEW2
gi|167629876|ref|YP_001680375.1| 498761.HM1_1799 WP_012282868.1.33279

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]