SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|167628327|ref|YP_001678826.1| from Heliobacterium modesticaldum Ice1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|167628327|ref|YP_001678826.1|
Domain Number 1 Region: 10-197
Classification Level Classification E-value
Superfamily Methylesterase CheB, C-terminal domain 4.05e-57
Family Methylesterase CheB, C-terminal domain 0.0000734
Further Details:      
 
Domain Number 2 Region: 273-467
Classification Level Classification E-value
Superfamily S-adenosyl-L-methionine-dependent methyltransferases 1.2e-44
Family Chemotaxis receptor methyltransferase CheR, C-terminal domain 0.00034
Further Details:      
 
Domain Number 3 Region: 939-1107
Classification Level Classification E-value
Superfamily ATPase domain of HSP90 chaperone/DNA topoisomerase II/histidine kinase 4.32e-41
Family Histidine kinase 0.0028
Further Details:      
 
Domain Number 4 Region: 1128-1250
Classification Level Classification E-value
Superfamily CheY-like 2.42e-18
Family CheY-related 0.0079
Further Details:      
 
Domain Number 5 Region: 724-831
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 0.000000000000401
Family Heme-binding PAS domain 0.039
Further Details:      
 
Domain Number 6 Region: 840-890,917-950
Classification Level Classification E-value
Superfamily Homodimeric domain of signal transducing histidine kinase 0.000000000216
Family Homodimeric domain of signal transducing histidine kinase 0.0041
Further Details:      
 
Domain Number 7 Region: 205-275
Classification Level Classification E-value
Superfamily Chemotaxis receptor methyltransferase CheR, N-terminal domain 0.0000000017
Family Chemotaxis receptor methyltransferase CheR, N-terminal domain 0.013
Further Details:      
 
Weak hits

Sequence:  gi|167628327|ref|YP_001678826.1|
Domain Number - Region: 624-708
Classification Level Classification E-value
Superfamily Tropomyosin 0.00128
Family Tropomyosin 0.0026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|167628327|ref|YP_001678826.1|
Sequence length 1257
Comment sensory transduction histidine kinase [Heliobacterium modesticaldum Ice1]
Sequence
MEERNRDNEQALWVLAIGASAGGLRAIQEVLNRLSPDKNLAVFVVQHLSPRYPSHLTAIL
KRTSLMDVKEAVQDEVICGGTIYVATPNHHLVLHGNRIHLDAESEKVKFARPSIDVLFES
AAEAFGSRVIGVVLSGTGSDGSNGIISIKEHGGFTIAQDSSNSHYNAMPQNAINTGAIDF
VLPLNEIPKIVSQILKEPDTVRRELTLDEHMEIADMLRRRLNIDVINYRRSTFKRRVRKR
MSQLHYASVQEYIEHLKQYPEELDELHDDLLINVTQFLRDEAAYESLRLNCLEPLIARAK
DGDTLRVWSVGCSTGEEPYSVAFMIADMLEASQKKLELKIYATDLDEAAILEARRGLYNE
SKVRSLPEAYREKYMIACGDFYKVKKHIRSCVIFGVQDIVHSAPIAKVDLLICRNLLIYF
DKELQKKVLTMFHYALNPGGFLFLGKSETTSVVPELFDFVDRRWKIYRARPVPTRRVPYL
RPRNSWIHLSESDNRLNRRFVADSVLENLAAPVIVLNEQMKIVLINRRADELLTNDIAEA
DKAELEREPLLFRLLGGTMQAEMQECFQSGLVPPSRDISATWREMPRHYVLSFFLDADED
RKPVLILTFTPVIRRTAGPVLLTEREIDSMEKELSDALSLAEELQSTNEELETTNEELQA
ANEELETTNEELESANEELETTNEELEAANEELETINEELEVRTLELLAVSALKNSVLTS
INVAVIAIDLEGRVLEWNPAATKLFDIPSYKAVNNNLFGLQVPPFFEELKPHLTRLIEGE
NETVSRTVIPWRNKSFNVDYVPLYNEEQQIVGLLIVAYDITEQHELQRQLQAALEKEHNL
AEELAMAKADAERANHMKTRFIAELSHDLRGSLNVILGVTQLGVETTSQPAQEGKGRQEG
KGLSEGEALPEREAFREEIATYFDMIRKAAENLNNLLTQVLELSSIELGKKAVENKVFSI
PQLADQVSAVIAYKARRARVDYNVDNRVPPRLLVESDFSKLCQILLNLLDNAVKYSQAGG
EVTFRISRDGDRLQLIIADRGIGMSPETVAHIFDPFYRAKGVSKITGSGLGMAITQQLVQ
TLKGEIHVESREGVGTTVTVAMPVRYLEMPAEADARGPIDMERLKASMTGRRVLIVDEDA
TSLLLLSRVITVLGGQPAVARGTEEAIAASTVQPPDLILTEAELPDGYAADMISAITKLM
GASPPVVLVTSDIFQVNQTGHWRAYADELTAKPVALNELYACLWRVLERSGSENRMA
Download sequence
Identical sequences B0TDV2
498761.HM1_0196 gi|167628327|ref|YP_001678826.1| WP_012281736.1.33279

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]