SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|167630525|ref|YP_001681024.1| from Heliobacterium modesticaldum Ice1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|167630525|ref|YP_001681024.1|
Domain Number 1 Region: 71-246
Classification Level Classification E-value
Superfamily S-adenosyl-L-methionine-dependent methyltransferases 1.33e-49
Family Chemotaxis receptor methyltransferase CheR, C-terminal domain 0.00015
Further Details:      
 
Domain Number 2 Region: 6-70
Classification Level Classification E-value
Superfamily Chemotaxis receptor methyltransferase CheR, N-terminal domain 0.00000000000288
Family Chemotaxis receptor methyltransferase CheR, N-terminal domain 0.0035
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|167630525|ref|YP_001681024.1|
Sequence length 261
Comment chemotaxis protein CheR [Heliobacterium modesticaldum Ice1]
Sequence
MTVVGDEYEIFIKKVYAKSGLDLSNYKRPQMERRIRTLARSQGVNDLLSYFALIDRDAEQ
YRKFIDHLTINVSEFLRNPSQWEILTTKILPMLLKENPLLKVWSAGCSTGEEPYSLAMTM
LESRCDMRNKVLATDLDTEVLRKAQIGIYSDKSLANVSPQMVSRYFEPQGSGFHRVKDDL
KRHIRFRQHNLLKDDFESGFDLILCRNVVIYFTEETKSLLYKRFHNALRKGGILFTGSTE
QIFQARELGFGTAATFFYQKL
Download sequence
Identical sequences B0TAG3
498761.HM1_2463 gi|167630525|ref|YP_001681024.1| WP_012283509.1.33279

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]