SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|170682806|ref|YP_001743584.1| from Escherichia coli SMS-3-5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|170682806|ref|YP_001743584.1|
Domain Number 1 Region: 50-236
Classification Level Classification E-value
Superfamily 4Fe-4S ferredoxins 2.93e-51
Family Ferredoxin domains from multidomain proteins 0.0006
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|170682806|ref|YP_001743584.1|
Sequence length 239
Comment iron-sulfur cluster-binding protein [Escherichia coli SMS-3-5]
Sequence
MSWIGWTVAATALGDNQMSFTRRKFVLGMGTVIFFTGSASSLLANTRQEKKVRYAMIHDE
SRCNGCNICARACRKTNHVPAQGSRLSIAHIPVTDNDNETQYHFFRQSCQHCEDAPCIDV
CPTAASWRDEQGIVRVEKSQCIGCSYCIGACPYQVRYLNPVTKVADKCDFCAESRLAKGF
PPICVSACPEHALIFGREDSPEIQAWLQENKYYQYQLPGAGKPHLYRRFGQHLIKKENV
Download sequence
Identical sequences A0A0G3K4D5 B1LEL6 V0SVT1 V0XDU6
439855.EcSMS35_1526 gi|170682806|ref|YP_001743584.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]