SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|167622090|ref|YP_001672384.1| from Shewanella halifaxensis HAW-EB4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|167622090|ref|YP_001672384.1|
Domain Number 1 Region: 34-256
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like II 1.56e-26
Family Phosphate binding protein-like 0.0072
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|167622090|ref|YP_001672384.1|
Sequence length 270
Comment extracellular solute-binding protein [Shewanella halifaxensis HAW-EB4]
Sequence
MLNLKRVIGLAVTAALVVGMPAQANEVIKLATTTSTENSGLLKNLLPTFEKETGYKVQVI
ATGTGKALKLARQGDVDVVMTHAPGAEAKFVEEGYGHLPRGIMENDFVVLGPKNDPAQIR
SSKTAEEAFAKIEKSGVPFISRGDNSGTNMKELLIWKNANITPDFKGYTAVGQGMGKTLL
MASELEAYTLSDRGTFVAYSGKIDLAVDFDGGAALANPYQIILISETKYPTLNHKGAKAL
SDWLIGAEAQGMINNYKVQGEQLFKATYSE
Download sequence
Identical sequences B0TN13
gi|167622090|ref|YP_001672384.1| WP_012275282.1.86919 458817.Shal_0149

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]