SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|169235519|ref|YP_001688719.1| from Halobacterium salinarum R1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|169235519|ref|YP_001688719.1|
Domain Number 1 Region: 1-168
Classification Level Classification E-value
Superfamily Ribosomal protein S5 domain 2-like 7.51e-34
Family GHMP Kinase, N-terminal domain 0.00049
Further Details:      
 
Domain Number 2 Region: 175-321
Classification Level Classification E-value
Superfamily GHMP Kinase, C-terminal domain 2.3e-32
Family Mevalonate 5-diphosphate decarboxylase 0.04
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|169235519|ref|YP_001688719.1|
Sequence length 325
Comment diphosphomevalonate decarboxylase [Halobacterium salinarum R1]
Sequence
MKATARAHPIQGLVKYHGMRDESLRMPYHDSISVCTAPSNTTTTVEFDPDRDADQYVVDG
DTVTGHGADRIRSVVDAVRDRAGFDHRVRLESQNSFPTNIGLGSSSSGFAAAALACVRAA
GLDLDLPTVSTVARRGSASAARAVTGGFSDLHAGLNDADCRSERLDAPAEFASDLRIVVG
EVPAYKETESAHAEAADSHMFDARLAHVQGQLAEMRDAVRAGDFQRVFETAEHDSLSLAA
TTMTGPSGWVYWKPETLSIFETVRELRADGVPTYFSTDTGATVYVNTTASHADEVEAAVA
DCGVDTAVWEVGGPAHELDERDAIF
Download sequence
Identical sequences B0R3Q6
gi|169235519|ref|YP_001688719.1| 478009.OE1893F WP_012289187.1.1784 WP_012289187.1.50382

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]