SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|169236033|ref|YP_001689233.1| from Halobacterium salinarum R1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|169236033|ref|YP_001689233.1|
Domain Number 1 Region: 12-161
Classification Level Classification E-value
Superfamily Ribosomal protein S5 domain 2-like 7.59e-21
Family GHMP Kinase, N-terminal domain 0.0077
Further Details:      
 
Weak hits

Sequence:  gi|169236033|ref|YP_001689233.1|
Domain Number - Region: 234-266
Classification Level Classification E-value
Superfamily GHMP Kinase, C-terminal domain 0.0619
Family Homoserine kinase 0.025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|169236033|ref|YP_001689233.1|
Sequence length 284
Comment shikimate kinase [Halobacterium salinarum R1]
Sequence
MDGRAVAPAAGTVLNALATGVGAAFALDIDTEASVSVTPSESGVSGEIAGHPEADTALVE
RCVSRVIDRYGDGQGGHVRTESEVPLAAGLKSSSAAANATVLATLDALGVADEVDRVDAA
RLGVQAARDAGVTVTGAFDDAAASMLGGVAMTDNREDDLLFRDAVEWHAAVWTPPERAYS
ADADVARCERVSGLAEHVAALAAAGDYGTAMTVNGLAFCAALDFPTAPAVTALPHAAGVS
LSGTGPSYVAVGDEDGIEEVSTRWHENPGTVRETTTQLAGARTT
Download sequence
Identical sequences B0R569 Q9HQB0
478009.OE2785R 64091.VNG1245C gi|169236033|ref|YP_001689233.1| gi|15790301|ref|NP_280125.1| WP_010902901.1.1784 WP_010902901.1.50382

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]