SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|169236188|ref|YP_001689388.1| from Halobacterium salinarum R1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|169236188|ref|YP_001689388.1|
Domain Number 1 Region: 5-233
Classification Level Classification E-value
Superfamily Metallo-dependent phosphatases 1.44e-43
Family 5'-nucleotidase (syn. UDP-sugar hydrolase), N-terminal domain 0.002
Further Details:      
 
Domain Number 2 Region: 257-445
Classification Level Classification E-value
Superfamily 5'-nucleotidase (syn. UDP-sugar hydrolase), C-terminal domain 2.35e-37
Family 5'-nucleotidase (syn. UDP-sugar hydrolase), C-terminal domain 0.00051
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|169236188|ref|YP_001689388.1|
Sequence length 449
Comment 5'-nucleotidase-like protein [Halobacterium salinarum R1]
Sequence
MSPGIYHYSDLENVYDTPERAGRLAGLLAGRDPDAITAGTGDNTAPGVLSLVTDGEQAMD
LYSAVDPDVATFGNHDFDYGPSRTAAVVADSPQTWVSANVYHDGDRVAGVEPWTLVERDG
TTLGFFGVLDADTPALNPMASDLTVTDPIQAATDAEAALRDAGAEYVIALSHLGRGDDEL
AAATTVDAVLGGHIASERVERLDGTLLTRPGAGGDVVFEIDIAADTVTRHQVDNAPRHDG
VTAALRDRLADAGLDAVVGHVTPPMERTERTLFEGESRIGNFVADAYRWAADADVGLQNA
GGVRDGPALAGDVTVADLVSVVPFAEPVSVAELTGRELLDVFRAGNGSGGLGFAEPDWWH
AHVSGATLEWRDGDGLVSASVGGDPVDPDATYTLATTDYLFYSDDEFPALDAGHRIDQLD
TQHEVLASYARQEGINPETEGRIRFHADD
Download sequence
Identical sequences B0R5M3
478009.OE3079F WP_012289330.1.1784 WP_012289330.1.50382 gi|169236188|ref|YP_001689388.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]