SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|169236827|ref|YP_001690027.1| from Halobacterium salinarum R1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|169236827|ref|YP_001690027.1|
Domain Number 1 Region: 6-188
Classification Level Classification E-value
Superfamily SGNH hydrolase 2.14e-19
Family TAP-like 0.033
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|169236827|ref|YP_001690027.1|
Sequence length 191
Comment hypothetical protein OE4176R [Halobacterium salinarum R1]
Sequence
MGVSRSIRVLGDSVAAGYGTDDSPAWPHRIADAPGESVSVTVRGGVGTTLTDHAADTATA
GDSGEVTVLVHAGHNDAQVGGDGDPRVSADAFRAAAARLDAALSAADRVTSHAFVGLLPL
LDVAGGVGFSAAQPQRALAFDDALAAAVDTHLPVARPIDAWRDRTRDGVHPTPTGHQAVA
STVADWLAGEP
Download sequence
Identical sequences B0R7G2
478009.OE4176R gi|169236827|ref|YP_001690027.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]