SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|440224620|ref|YP_007338016.1| from Rhizobium tropici CIAT 899

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|440224620|ref|YP_007338016.1|
Domain Number 1 Region: 25-102
Classification Level Classification E-value
Superfamily 2Fe-2S ferredoxin-like 3.71e-16
Family 2Fe-2S ferredoxin domains from multidomain proteins 0.047
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|440224620|ref|YP_007338016.1|
Sequence length 107
Comment hypothetical protein RTCIAT899_PC08415 [Rhizobium tropici CIAT 899]
Sequence
MSKGPRLAGEAGRIVRLAEQGRAPVRFLLDGIEREALAGDTVLTAMLTFSPVLRRSEFGP
EGRAGFCLMGACQDCWVWQQNGTRLRACSTLVGNGMSLTTQAPGDWP
Download sequence
Identical sequences L0LZC9
gi|440224620|ref|YP_007338016.1| gi|440224620|ref|YP_007338016.1|NC_020062 WP_015343678.1.25425

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]