SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|440228191|ref|YP_007335282.1| from Rhizobium tropici CIAT 899

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|440228191|ref|YP_007335282.1|
Domain Number 1 Region: 130-257
Classification Level Classification E-value
Superfamily alpha-helical ferredoxin 8.37e-36
Family Fumarate reductase/Succinate dehydogenase iron-sulfur protein, C-terminal domain 0.00000735
Further Details:      
 
Domain Number 2 Region: 27-128
Classification Level Classification E-value
Superfamily 2Fe-2S ferredoxin-like 6.37e-30
Family 2Fe-2S ferredoxin domains from multidomain proteins 0.00036
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|440228191|ref|YP_007335282.1|
Sequence length 259
Comment succinate dehydrogenase iron-sulfur subunit [Rhizobium tropici CIAT 899]
Sequence
MVELALPKNSQMREGKVWPKPVGAKNTREFRVYRWSPDDGQNPSIDTYYIDIDDCGPMVL
DGLLYIKNNIDPTLTLRRSCREGICGSCAMNIDGTNTLACTKGLDEIKGTVKVYPLPHMP
VVKDLVPDLTNFYAQHRSIEPWLKTVSPPPAKEWKQSHEDRLKLDGLYECILCACCSTSC
PSYWWNGDRYLGPAVLLQAYRWLIDSRDEAKGERLDNLEDPFRLYRCHTIMNCAQTCPKG
LNPAKAIAEIKKMMVERRV
Download sequence
Identical sequences L0LPT6
WP_015341415.1.25425 gi|440228191|ref|YP_007335282.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]