SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|339629681|ref|YP_004721324.1| from Sulfobacillus acidophilus TPY

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|339629681|ref|YP_004721324.1|
Domain Number 1 Region: 3-207
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 1.22e-56
Family G proteins 0.00018
Further Details:      
 
Domain Number 2 Region: 153-302
Classification Level Classification E-value
Superfamily Translation proteins 9.42e-30
Family Elongation factors 0.0045
Further Details:      
 
Domain Number 3 Region: 400-513
Classification Level Classification E-value
Superfamily EF-G C-terminal domain-like 3.69e-26
Family EF-G/eEF-2 domains III and V 0.0092
Further Details:      
 
Domain Number 4 Region: 304-389
Classification Level Classification E-value
Superfamily EF-G C-terminal domain-like 0.000000000000288
Family EF-G/eEF-2 domains III and V 0.0039
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|339629681|ref|YP_004721324.1|
Sequence length 608
Comment GTP-binding protein TypA [Sulfobacillus acidophilus TPY]
Sequence
MERQDVRNIAIIAHVDHGKTTLVDAMLKQSGMFRDPSQLQERALDANPLERERGITILAK
NTAITYRGVLINIVDTPGHADFGGEVERILSMVDGALLVVDANEGPMPQTRYVLQKALKA
GLRPVVVLNKMDREGARPEEVLEAVLELFIDLEASDDQLDFPVIYASAKAGIASNTAPLP
PEGNLEPLFEAILAHIPYPVGDETAPLQVLITTLDHDDYVGRLAIGRVRQGRLTLGQTVA
LAHADGTVERVRPSKLYGRIGLKRVELESVTVGDIVTLAGLEDANIGDTVTDPDNPQPLP
PISVDEPTLTILVGVNTSPFAGLEGQFITSRQLRDRLFREQQRNVALRVEETEDADVFRV
SGRGELHIGILLEEMRREGYEMEVSKPEVILKETPDGLMEPMERLYLDVPDEYVGAVMEL
LGPRRATMVAMGQAGPGQTRLEFVISARGLLGFRSAFINQTRGYGIMNHLFDGYQPYSGP
IEEMPRGALIAIETGTATAYALDNAQERGVLFIGPGTPVYAGMVVGEHSRPSDLEINVCK
KKHVTNMRSSTAEEGIRLTPPRVLTLDQALEYVKSDELVEITPKSIRLRKATLDPHQRKR
ERIQRQSS
Download sequence
Identical sequences F8IAA3 G8TXM6
gi|339629681|ref|YP_004721324.1| gi|379007203|ref|YP_005256654.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]