SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|182680471|ref|YP_001834617.1| from Beijerinckia indica subsp. indica ATCC 9039

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|182680471|ref|YP_001834617.1|
Domain Number 1 Region: 16-206
Classification Level Classification E-value
Superfamily ITPase-like 2.49e-45
Family Maf-like 0.00016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|182680471|ref|YP_001834617.1|
Sequence length 212
Comment Maf family protein [Beijerinckia indica subsp. indica ATCC 9039]
Sequence
MVQADAPAKHLWRNPLPLVLASKSQARRDLLTATGLPFECLDASIDERAVEDPLRRQGGQ
AADIAAHLARAKALAIGARRPDHLVIGADQVLSLEGALFSKPRDLDEAADHLARFSGKTH
ELHAALCVTRGGRVLFEGVPVARMRMRVLSPVFIKAYIEAAGTNALSSVGAYQLEHLGVH
LFEEIEGDQSTILGLPLIPLLAFLRDEGSLLG
Download sequence
Identical sequences B2IG54
395963.Bind_3571 gi|182680471|ref|YP_001834617.1| WP_012386476.1.21334

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]