SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|550446306|ref|YP_008662091.1| from Klebsiella pneumoniae CG43

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|550446306|ref|YP_008662091.1|
Domain Number 1 Region: 3-363
Classification Level Classification E-value
Superfamily FMN-linked oxidoreductases 3.38e-108
Family FMN-linked oxidoreductases 0.0000000000646
Further Details:      
 
Domain Number 2 Region: 334-520
Classification Level Classification E-value
Superfamily Nucleotide-binding domain 1.29e-41
Family N-terminal domain of adrenodoxin reductase-like 0.00000152
Further Details:      
 
Domain Number 3 Region: 462-519,557-651
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 3.3e-24
Family C-terminal domain of adrenodoxin reductase-like 0.00000237
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|550446306|ref|YP_008662091.1|
Sequence length 673
Comment 2,4-dienoyl-CoA reductase [Klebsiella pneumoniae CG43]
Sequence
MSRYPSLFAPLELGFTTLKNRVLMGSMHTGLEELPDGAQRLAAFYAERARHGVALIVTGG
IAPAPSGVTMAGGAVLNDASHLAHHRHITDAVHQEGGKIALQILHTGRYSYQPALVAPSA
LQAPINRFTPHELSHDEIMTLIDDFAHCAQLAREAGYDGVEVMGSEGYLINEFLAARTNQ
RDDQWGGDYARRMRFAVEVVKAVRQRAGHDFIIIYRLSMLDLVNDGSTLAEVTELAKAIE
AAGATIINTGIGWHEARIPTIATPVPRGAFSWVTRKLKGAVSIPLITTNRINDPQVAEDI
LARGDADMVSMARPFLADAEFISKAQDDRADQINTCIGCNQACLDRIFVGKVTSCLVNPR
ACHETLMPVLPANAPKRLAVVGAGPAGLAFAVNAAARGHHVTLFDALPEIGGQFNIAKQI
PGKEEFHETLRYYRTMLDLHGVDLRLNTRVTTDDLLAFDETILATGIAPRLPAIDGIDHP
KVLSYLDVLRDKAPVGAKVAIIGCGGIGFDTAMFLSQSGVATSQNIGEFCREWGIDTSLQ
TAGGLSAEGPQLSKSPRQIVMLQRKASKPGEGLGKTTGWIHRATLLARGVKMIPAVSYEK
IDDEGLHVTIGGERQLLAVDQVVICAGQEPRRELADPLRAAGKTVHLIGGCDVAAELDAR
RAIAQGTKLALAI
Download sequence
Identical sequences WP_004210522.1.100611 WP_004210522.1.34826 WP_004210522.1.35496 WP_004210522.1.4430 WP_004210522.1.49194 WP_004210522.1.57421 WP_004210522.1.61940 WP_004210522.1.84417 gi|550446306|ref|YP_008662091.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]