SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|170022767|ref|YP_001719272.1| from Yersinia pseudotuberculosis YPIII

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|170022767|ref|YP_001719272.1|
Domain Number 1 Region: 13-96
Classification Level Classification E-value
Superfamily SpoIIaa-like 1.04e-16
Family Anti-sigma factor antagonist SpoIIaa 0.0074
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|170022767|ref|YP_001719272.1|
Sequence length 100
Comment putative anti-sigma B factor antagonist [Yersinia pseudotuberculosis YPIII]
Sequence
MAGELSWQSLQETLVLQGELDRETLLPLWQQRETLLADKSRIDVSQLQRVDSSGLALLVH
FRELQSQRGHSLEIIGISNRLATLIELYNLQQIIPVETAS
Download sequence
Identical sequences A0A0E1NXV3 A0A0H2YMJ2 A0A0H3AZ72 A0A0M1V9D0 A0A0U1EWG6 A0A0U1QUK0 A0A208S2Y8 A0A2A7VJS7 Q0WB80 Q665K2 Q7CL92
gi|294505307|ref|YP_003569369.1| gi|51597807|ref|YP_071998.1| gi|45443557|ref|NP_995096.1| gi|384127588|ref|YP_005510202.1| gi|162420439|ref|YP_001605688.1| gi|186896999|ref|YP_001874111.1| gi|153947165|ref|YP_001399445.1| gi|170022767|ref|YP_001719272.1| gi|145597642|ref|YP_001161718.1| gi|108813613|ref|YP_649380.1| gi|384138576|ref|YP_005521278.1| 187410.y0142 214092.YPO3571 229193.YP_3826 273123.YPTB3515 349746.YpAngola_A1142 349747.YpsIP31758_0452 360102.YPA_3732 377628.YPN_3453 386656.YPDSF_0326 502800.YPK_0516 502801.YPTS_3701 WP_002210125.1.100083 WP_002210125.1.100246 WP_002210125.1.100593 WP_002210125.1.10066 WP_002210125.1.100921 WP_002210125.1.100931 WP_002210125.1.10105 WP_002210125.1.101305 WP_002210125.1.101382 WP_002210125.1.101928 WP_002210125.1.102012 WP_002210125.1.102067 WP_002210125.1.10736 WP_002210125.1.10935 WP_002210125.1.10955 WP_002210125.1.11693 WP_002210125.1.12167 WP_002210125.1.12463 WP_002210125.1.12736 WP_002210125.1.12857 WP_002210125.1.1388 WP_002210125.1.14063 WP_002210125.1.14169 WP_002210125.1.15321 WP_002210125.1.15555 WP_002210125.1.15605 WP_002210125.1.15689 WP_002210125.1.16243 WP_002210125.1.16333 WP_002210125.1.17135 WP_002210125.1.17141 WP_002210125.1.17608 WP_002210125.1.17873 WP_002210125.1.17983 WP_002210125.1.18208 WP_002210125.1.18640 WP_002210125.1.18826 WP_002210125.1.19329 WP_002210125.1.19425 WP_002210125.1.19739 WP_002210125.1.19763 WP_002210125.1.20035 WP_002210125.1.20380 WP_002210125.1.2064 WP_002210125.1.20932 WP_002210125.1.21486 WP_002210125.1.21784 WP_002210125.1.21879 WP_002210125.1.21934 WP_002210125.1.22530 WP_002210125.1.22542 WP_002210125.1.22708 WP_002210125.1.23157 WP_002210125.1.23271 WP_002210125.1.23687 WP_002210125.1.23811 WP_002210125.1.24002 WP_002210125.1.2451 WP_002210125.1.24517 WP_002210125.1.25181 WP_002210125.1.25394 WP_002210125.1.26383 WP_002210125.1.2640 WP_002210125.1.26776 WP_002210125.1.26960 WP_002210125.1.27124 WP_002210125.1.27251 WP_002210125.1.2726 WP_002210125.1.28647 WP_002210125.1.28922 WP_002210125.1.29157 WP_002210125.1.29186 WP_002210125.1.29355 WP_002210125.1.2947 WP_002210125.1.29622 WP_002210125.1.2964 WP_002210125.1.29685 WP_002210125.1.29814 WP_002210125.1.3092 WP_002210125.1.30931 WP_002210125.1.311 WP_002210125.1.31336 WP_002210125.1.31496 WP_002210125.1.31721 WP_002210125.1.31739 WP_002210125.1.31805 WP_002210125.1.32343 WP_002210125.1.32388 WP_002210125.1.32446 WP_002210125.1.32736 WP_002210125.1.33203 WP_002210125.1.33324 WP_002210125.1.33661 WP_002210125.1.33775 WP_002210125.1.33937 WP_002210125.1.34031 WP_002210125.1.34138 WP_002210125.1.35389 WP_002210125.1.35538 WP_002210125.1.36088 WP_002210125.1.37174 WP_002210125.1.37494 WP_002210125.1.37863 WP_002210125.1.38147 WP_002210125.1.38532 WP_002210125.1.38743 WP_002210125.1.38824 WP_002210125.1.38993 WP_002210125.1.39066 WP_002210125.1.39346 WP_002210125.1.3976 WP_002210125.1.39858 WP_002210125.1.40071 WP_002210125.1.40134 WP_002210125.1.40534 WP_002210125.1.40853 WP_002210125.1.41196 WP_002210125.1.41984 WP_002210125.1.4210 WP_002210125.1.42361 WP_002210125.1.42490 WP_002210125.1.42976 WP_002210125.1.44408 WP_002210125.1.44598 WP_002210125.1.44603 WP_002210125.1.44832 WP_002210125.1.45198 WP_002210125.1.45214 WP_002210125.1.46262 WP_002210125.1.46545 WP_002210125.1.46686 WP_002210125.1.46697 WP_002210125.1.46731 WP_002210125.1.4678 WP_002210125.1.46891 WP_002210125.1.47387 WP_002210125.1.47440 WP_002210125.1.47769 WP_002210125.1.47881 WP_002210125.1.48166 WP_002210125.1.48722 WP_002210125.1.4889 WP_002210125.1.49315 WP_002210125.1.49906 WP_002210125.1.4997 WP_002210125.1.50010 WP_002210125.1.50093 WP_002210125.1.50106 WP_002210125.1.50185 WP_002210125.1.50984 WP_002210125.1.51284 WP_002210125.1.51293 WP_002210125.1.51588 WP_002210125.1.51772 WP_002210125.1.51934 WP_002210125.1.52158 WP_002210125.1.52247 WP_002210125.1.52734 WP_002210125.1.52792 WP_002210125.1.52819 WP_002210125.1.52969 WP_002210125.1.53147 WP_002210125.1.53300 WP_002210125.1.53838 WP_002210125.1.53848 WP_002210125.1.53883 WP_002210125.1.53953 WP_002210125.1.54568 WP_002210125.1.54951 WP_002210125.1.55194 WP_002210125.1.55695 WP_002210125.1.5592 WP_002210125.1.56031 WP_002210125.1.56912 WP_002210125.1.56953 WP_002210125.1.57585 WP_002210125.1.57657 WP_002210125.1.58067 WP_002210125.1.58543 WP_002210125.1.58794 WP_002210125.1.59102 WP_002210125.1.59431 WP_002210125.1.5957 WP_002210125.1.59635 WP_002210125.1.5968 WP_002210125.1.59687 WP_002210125.1.59789 WP_002210125.1.59885 WP_002210125.1.60437 WP_002210125.1.60707 WP_002210125.1.60896 WP_002210125.1.61689 WP_002210125.1.62232 WP_002210125.1.62342 WP_002210125.1.6270 WP_002210125.1.6333 WP_002210125.1.63387 WP_002210125.1.63641 WP_002210125.1.64142 WP_002210125.1.64474 WP_002210125.1.64780 WP_002210125.1.64786 WP_002210125.1.64910 WP_002210125.1.653 WP_002210125.1.65400 WP_002210125.1.65554 WP_002210125.1.6570 WP_002210125.1.65706 WP_002210125.1.65718 WP_002210125.1.6581 WP_002210125.1.66118 WP_002210125.1.66546 WP_002210125.1.66616 WP_002210125.1.67404 WP_002210125.1.67850 WP_002210125.1.6791 WP_002210125.1.68361 WP_002210125.1.68371 WP_002210125.1.68753 WP_002210125.1.68855 WP_002210125.1.69018 WP_002210125.1.69316 WP_002210125.1.69951 WP_002210125.1.70117 WP_002210125.1.70171 WP_002210125.1.70319 WP_002210125.1.70377 WP_002210125.1.70417 WP_002210125.1.70726 WP_002210125.1.7083 WP_002210125.1.7169 WP_002210125.1.71744 WP_002210125.1.72280 WP_002210125.1.72440 WP_002210125.1.72486 WP_002210125.1.7402 WP_002210125.1.74131 WP_002210125.1.74310 WP_002210125.1.74577 WP_002210125.1.74738 WP_002210125.1.75169 WP_002210125.1.75173 WP_002210125.1.7518 WP_002210125.1.75208 WP_002210125.1.75337 WP_002210125.1.75407 WP_002210125.1.75636 WP_002210125.1.75689 WP_002210125.1.75821 WP_002210125.1.76555 WP_002210125.1.76670 WP_002210125.1.77295 WP_002210125.1.77387 WP_002210125.1.77429 WP_002210125.1.77569 WP_002210125.1.77691 WP_002210125.1.78004 WP_002210125.1.7841 WP_002210125.1.78556 WP_002210125.1.79515 WP_002210125.1.79550 WP_002210125.1.79609 WP_002210125.1.79825 WP_002210125.1.79981 WP_002210125.1.8009 WP_002210125.1.80331 WP_002210125.1.81848 WP_002210125.1.81877 WP_002210125.1.8210 WP_002210125.1.82133 WP_002210125.1.82151 WP_002210125.1.82270 WP_002210125.1.82436 WP_002210125.1.82619 WP_002210125.1.8303 WP_002210125.1.83039 WP_002210125.1.83265 WP_002210125.1.83630 WP_002210125.1.8420 WP_002210125.1.84703 WP_002210125.1.84720 WP_002210125.1.85269 WP_002210125.1.85270 WP_002210125.1.8559 WP_002210125.1.85802 WP_002210125.1.86034 WP_002210125.1.86059 WP_002210125.1.86413 WP_002210125.1.87107 WP_002210125.1.8728 WP_002210125.1.87418 WP_002210125.1.8762 WP_002210125.1.87853 WP_002210125.1.87988 WP_002210125.1.88362 WP_002210125.1.88472 WP_002210125.1.89359 WP_002210125.1.89542 WP_002210125.1.8964 WP_002210125.1.90176 WP_002210125.1.9051 WP_002210125.1.90624 WP_002210125.1.91263 WP_002210125.1.91373 WP_002210125.1.91844 WP_002210125.1.92030 WP_002210125.1.92331 WP_002210125.1.92604 WP_002210125.1.927 WP_002210125.1.9311 WP_002210125.1.9320 WP_002210125.1.93623 WP_002210125.1.93928 WP_002210125.1.93933 WP_002210125.1.94052 WP_002210125.1.94201 WP_002210125.1.94545 WP_002210125.1.94683 WP_002210125.1.95746 WP_002210125.1.95981 WP_002210125.1.97245 WP_002210125.1.97375 WP_002210125.1.97448 WP_002210125.1.97791 WP_002210125.1.97864 WP_002210125.1.97872 WP_002210125.1.97894 WP_002210125.1.99109 WP_002210125.1.99383 WP_002210125.1.9941 WP_002210125.1.99416 WP_002210125.1.99788 WP_002210125.1.99882 WP_002210125.1.99972 WP_002210125.1.99990 YP_002348458.1.25044 gi|108809723|ref|YP_653639.1| gi|218930583|ref|YP_002348458.1| gi|384416609|ref|YP_005625971.1| gi|384123774|ref|YP_005506394.1| gi|22124062|ref|NP_667485.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]