SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|530616237|ref|YP_008422898.1| from Bacillus amyloliquefaciens subsp. plantarum UCMB5113

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|530616237|ref|YP_008422898.1|
Domain Number 1 Region: 2-101
Classification Level Classification E-value
Superfamily Enzyme IIa from lactose specific PTS, IIa-lac 5.23e-34
Family Enzyme IIa from lactose specific PTS, IIa-lac 0.0005
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|530616237|ref|YP_008422898.1|
Sequence length 105
Comment Oligo-beta-mannoside-specific phosphotransferase enzyme IIA component [Bacillus amyloliquefaciens subsp. plantarum UCMB5113]
Sequence
MKTYTDEQISFQLILHSGNARSNIIQSIRAYKDGRTDESDTFLTKAEEELGKAHDIHFQM
IQKEAGGAKTDVSLLFMHAEDHLMSALSMKELVKEMLDLFQSKNL
Download sequence
Identical sequences gi|530616237|ref|YP_008422898.1| WP_020958029.1.3136 WP_020958029.1.37381 WP_020958029.1.52960 WP_020958029.1.68714

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]