SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|170758433|ref|YP_001787693.1| from Clostridium botulinum A3 str. Loch Maree

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  gi|170758433|ref|YP_001787693.1|
Domain Number - Region: 169-227
Classification Level Classification E-value
Superfamily NfeD domain-like 0.000615
Family NfeD domain-like 0.0071
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|170758433|ref|YP_001787693.1|
Sequence length 234
Comment hypothetical protein CLK_1758 [Clostridium botulinum A3 str. Loch Maree]
Sequence
MEIKNHIMDQKKVYIKIGYSSDDAEKAAIKDMGDPKATGKMLDSVHPPTIDWIQIIALIM
ITLTLQILKMLSELGGSDFSSIAPIDILRIIGIFLSAYALIWIGIEKYSDLPFFYGKSQR
GGSNANGVFICSLAIVMISHSLLQTIILLLIFAPIIAIERSIIESKRIKKEQKFLWQQGI
AYEDFNYKGNAIFNNSPRKVYSQNEPIKKGDPIIITKIDGFNLVVEKQDLHNNN
Download sequence
Identical sequences B1KWH1
498214.CLK_1758 gi|170758433|ref|YP_001787693.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]