SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|172038078|ref|YP_001804579.1| from Cyanothece sp. ATCC 51142

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|172038078|ref|YP_001804579.1|
Domain Number 1 Region: 4-117
Classification Level Classification E-value
Superfamily RbcX-like 3.14e-42
Family RbcX-like 0.0000227
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|172038078|ref|YP_001804579.1|
Sequence length 132
Comment chaperonin-like protein RbcX [Cyanothece sp. ATCC 51142]
Sequence
MYPKKIANDTAEVIQNYLTYQAVRIILDQLSETNPKQAIWLRQYTASHNIQKGESFIEGL
MGEDKELVMRILKVREYLASEVMEFMPQMVRHGISQANMEHRRQLLERLTRSSSVSSTSS
ESENDDSNPNCD
Download sequence
Identical sequences B1WXH2
43989.cce_3165 gi|172038078|ref|YP_001804579.1| WP_009547486.1.18909 WP_009547486.1.94124

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]