SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|172038584|ref|YP_001805085.1| from Cyanothece sp. ATCC 51142

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|172038584|ref|YP_001805085.1|
Domain Number 1 Region: 239-255,341-519
Classification Level Classification E-value
Superfamily Ribonuclease H-like 3.52e-16
Family DnaQ-like 3'-5' exonuclease 0.087
Further Details:      
 
Domain Number 2 Region: 268-317
Classification Level Classification E-value
Superfamily Sec63 N-terminal domain-like 0.00000759
Family Achaeal helicase C-terminal domain 0.025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|172038584|ref|YP_001805085.1|
Sequence length 525
Comment hypothetical protein cce_3671 [Cyanothece sp. ATCC 51142]
Sequence
MAKVRIKNITCSLSEREIIIDTGTFLTKMLITDSLLLDYKRCSRRAFLNIHGDPTQQDPE
RDFLQKLRQESKRHIASVLDTFYSHYQPSYTSGANWREKAQLTEQLMQQGVDCIYQGILW
VDDSSSSKHLPDDFLHFLSSGDEYLGKPHLLIKQPGQSKFGDWSYYPVSIHLGRKAKPEY
KLIVTFYAQLLAIIQETLPPTPQLIVRPLKHFSVEVIQWLPKLQLVLDECVTMLGTMQEP
EVFIARQRCHLCRWYGHCHAIAHSQQHLSLVPGVTPSRYRSLRDIGVITTRSLAEANFDT
IEELIGRGLAQKLQQQARSLVHNHAIPRSQSQYNFSEILSNETVELYFDIEAEPERNLDY
LLGVVVVNRLNQTQTFYPFLAETPEEEGIIWEQFLELVNTYHQAPIFHFSDYEKDTIKRL
GNLYQTPDRNIQHLLSRLIDLHHCVISSVILPVENYSLKSLANWLGFHWRDVGVSGDQCV
CWYDQWLTTGDRHYLTSILRYNEDDCLATLHLKNWLAEFFNNIEF
Download sequence
Identical sequences B1X0Y0
43989.cce_3671 gi|172038584|ref|YP_001805085.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]