SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|183980331|ref|YP_001848622.1| from Mycobacterium marinum M

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|183980331|ref|YP_001848622.1|
Domain Number 1 Region: 71-252
Classification Level Classification E-value
Superfamily Rhomboid-like 3.14e-41
Family Rhomboid-like 0.001
Further Details:      
 
Domain Number 2 Region: 6-47
Classification Level Classification E-value
Superfamily B-box zinc-binding domain 0.00000435
Family B-box zinc-binding domain 0.0078
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|183980331|ref|YP_001848622.1|
Sequence length 289
Comment serine protease [Mycobacterium marinum M]
Sequence
MSGPSAPESPACYRHPGRPTYVRCTRCDRYICGDCMRSGAVGHQCVECVRADARTVRQPR
TQFGGRQRSVTPVVTFSLIAVSVLVFVLQLVVAGLGPHLALWPPAVADGQLYRLVTSAFM
HYGTLHLVFNMWALYIVGPPLEMWLGRLRFGGLYALSALGGSVLVYLIAPLNTATAGASG
AIFGLFGATFVVAKRLNLDIRWVVALIAINLAITFVAPAVGSQLISWQGHVGGLITGALV
AAAYVYAPRERRNFIQGAVTLTVAVAFVVLIWWRTSELLAMFGGHLNLG
Download sequence
Identical sequences B2HKR2
216594.MMAR_0300 gi|183980331|ref|YP_001848622.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]