SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|183981191|ref|YP_001849482.1| from Mycobacterium marinum M

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|183981191|ref|YP_001849482.1|
Domain Number 1 Region: 3-178
Classification Level Classification E-value
Superfamily Pentapeptide repeat-like 2.26e-45
Family Pentapeptide repeats 0.0000000539
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|183981191|ref|YP_001849482.1|
Sequence length 182
Comment hypothetical protein MMAR_1169 [Mycobacterium marinum M]
Sequence
MEHWVDCEFTDRDFRDEDLSRLRTERVVFSECNFGGVNLTESEHRGSAFRNCSFERTTLW
HSTFAQCSMLGSVFVSCRMRPLVLDEVDFTLAVLGGNDLRGVDLSGCRLREASLVETDLR
KSVLRGADLRGARTNGTKLDDADLRGANLDPSLWRSASLAGARIDVPQALSFALAHGLRL
DS
Download sequence
Identical sequences B2HDR1
gi|183981191|ref|YP_001849482.1| WP_012393050.1.90902 216594.MMAR_1169

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]