SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|183982171|ref|YP_001850462.1| from Mycobacterium marinum M

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|183982171|ref|YP_001850462.1|
Domain Number 1 Region: 119-311,398-559
Classification Level Classification E-value
Superfamily Class II aaRS and biotin synthetases 1.47e-96
Family Class II aminoacyl-tRNA synthetase (aaRS)-like, catalytic domain 0.0000000451
Further Details:      
 
Domain Number 2 Region: 289-411
Classification Level Classification E-value
Superfamily GAD domain-like 5.01e-33
Family GAD domain 0.00036
Further Details:      
 
Domain Number 3 Region: 5-106
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 9.14e-29
Family Anticodon-binding domain 0.00011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|183982171|ref|YP_001850462.1|
Sequence length 593
Comment aspartyl-tRNA synthetase [Mycobacterium marinum M]
Sequence
MFVLRSHAAGALRDSDAGRQVTLAGWVARRRDHGGVIFIDLRDASGIAQVVFREADVLAQ
AHRLRAEFCVAVTGVVEIRPEGNANPEIATGDIEVNASSLTVLGECAPLPFQLDEPAGEE
LRLKYRYLDLRRDGPASAIRLRSKVNAAARAVLAGHDFVEIETPTITRSTPEGARDFLVP
ARLHPGMFYALPQSPQLFKQLLMVAGMERYYQIARCYRDEDFRADRQPEFTQLDMELSFV
DVEDIIAVSEEILTALWALIGYRIPTPIPRISYADAMRRFGSDKPDLRFGLELVECAEFF
KDTTFRVFQAPYVGAVVMPGGASQPRRTLDGWQEWAKQRGHRGLAYVLVGEDGTLGGPVA
KNLTDAERDGLAAHVGASPGDCIFFSAGPVKASRALLGAARIEIAERLNLIDPSAWEFVW
VVDPPLFEPAEDATASGDVAVGSGAWTAVHHAFTAPKPELEDRIESDPGSVLADAYDIVC
NGHEIGGGSIRIHRRDIQERVFAVMGLSKAEAEEKFGFLLEAFTFGAPPHGGIAFGWDRV
STLLAGADSIRDVIAFPKTGGGVDPLTEAPAPITAQQRKEAGIDAKPKQVEGT
Download sequence
Identical sequences B2HNA9
216594.MMAR_2158 gi|183982171|ref|YP_001850462.1| MymaA.00145.a WP_012393924.1.39490 WP_012393924.1.48473 WP_012393924.1.5386 WP_012393924.1.90902

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]