SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|183984059|ref|YP_001852350.1| from Mycobacterium marinum M

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|183984059|ref|YP_001852350.1|
Domain Number 1 Region: 3-300
Classification Level Classification E-value
Superfamily ATP synthase (F1-ATPase), gamma subunit 3.53e-80
Family ATP synthase (F1-ATPase), gamma subunit 0.0000322
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|183984059|ref|YP_001852350.1|
Sequence length 304
Comment F0F1 ATP synthase subunit gamma [Mycobacterium marinum M]
Sequence
MAATLRELRGRIRSAGSIKKITKAQELIATSRIARAQARLESARPYADQITQMLTTLAAD
AALDHPLLVEHPQPKRAGVLVVSSDRGLCGAYNANVFRRSEELFSLLRDEGKQPVLYVVG
RKALAYYTFRNWDIAQSWTGFSEQPKYENAAEIASTLVDAFMLGAGEGEDQQTNNEQSVD
ELHIVFTEFKSMLSQSTEARRMAPMVVEYVEETGPRTLYSFEPDATTLFESLLPRYLTTR
VYAAMLESAASELASRQRAMKSATDNADDLIKALTLMANRERQAQITQEISEIVGGANAL
ADAR
Download sequence
Identical sequences B2HQK3
gi|183984059|ref|YP_001852350.1| WP_012395671.1.90902 216594.MMAR_4088

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]