SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|183985186|ref|YP_001853477.1| from Mycobacterium marinum M

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|183985186|ref|YP_001853477.1|
Domain Number 1 Region: 4-479
Classification Level Classification E-value
Superfamily Heme-dependent catalase-like 1.05e-195
Family Heme-dependent catalases 0.000000000192
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|183985186|ref|YP_001853477.1|
Sequence length 482
Comment catalase KatE [Mycobacterium marinum M]
Sequence
MAERYTTTDAGSPAPSDDQSLTIGPDGPILLQDHYLIEQMAMFNRERIPERQPHAKGGGA
HGHFEVTHDVSKYTRAAVFAPGAKTDTLIRFSTVAGERGSPDTWRDPRGFALKFYTSEGN
FDMVGNNTPVFFMRDPLKFQHFIRSQKRMQATNLRDHNMQWDFWSLSPESAHQVTWLMGD
RGIPKSWRHMNGYSSHTYSWINAADEIFWVKYHFITDQGIDFLTQEDADRLAGTDGDYHQ
RDLYEAIERGDFPSWTLKMQIMGFEEAKSYRFNPFDLTKVWPHSDYPLIDVGKLTLDRNV
TDYHTEIEQAAFEPNNIVPGTGLSPDKMLLARGFSYSDAHRARLGTNYRQIPVNSPIVQV
NSYSKDGAMRVRNASDPVYAPNSYGGPQADPARAAEVRWHADGQMMRAAYTPHPEDDDWG
QAGTMVREVLDDSARDRLVSNIIGHVCKGVKEPVLSRVFEYWRNVDPDLGKAVEEGVRAN
SS
Download sequence
Identical sequences B2HKC5
gi|183985186|ref|YP_001853477.1| WP_012396729.1.90902 216594.MMAR_5217

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]