SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|170719455|ref|YP_001747143.1| from Pseudomonas putida W619

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|170719455|ref|YP_001747143.1|
Domain Number 1 Region: 22-202
Classification Level Classification E-value
Superfamily ClpP/crotonase 1.15e-28
Family Clp protease, ClpP subunit 0.039
Further Details:      
 
Domain Number 2 Region: 375-441
Classification Level Classification E-value
Superfamily NfeD domain-like 0.000000575
Family NfeD domain-like 0.0078
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|170719455|ref|YP_001747143.1|
Sequence length 449
Comment hypothetical protein PputW619_0268 [Pseudomonas putida W619]
Sequence
MIARCWRWWLLVLMLGFAPGSQAAPGAIWVLSIDDAIGPASADYLMRGLDQAREQGAQLV
VIRMDTPGGLDSAMRQIIKVILASPVPVATFVAPGGARAASAGTYILYASHVAAMAPGTN
LGAATPVQVGSPTGAPKDDKAKNDTNEQALARKQVNDAAAYIRGLAQLRGRNADWAEKAV
REAVSLSASEAFKQKVIDHVANDLPDLLRQLDGKTLIAADQPRQLQTRDASLVEHVPDWR
TRLLAVITNPSVALILIMIGVYGLLFEFMNPGSGVGGVVGGICLLLALYALQLLPVSFAG
VALVMLGIAFMIAEAFLPSFGVVGFGGIVAFVVGAVILIDTDAPGFGIPLGLIASLAMLS
ALLIGGVLGMALKARKRALVSGDAGLVGSLVTVTQVVAGNPFCGAVMAQGEQWQVQCTTP
LQLGQQVRVTARHGVMLEVSAAAPTAQGE
Download sequence
Identical sequences B1J3E3
WP_012312215.1.83615 390235.PputW619_0268 gi|170719455|ref|YP_001747143.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]