SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|170720475|ref|YP_001748163.1| from Pseudomonas putida W619

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  gi|170720475|ref|YP_001748163.1|
Domain Number - Region: 31-70
Classification Level Classification E-value
Superfamily NfeD domain-like 0.00248
Family NfeD domain-like 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|170720475|ref|YP_001748163.1|
Sequence length 122
Comment hypothetical protein PputW619_1289 [Pseudomonas putida W619]
Sequence
MSRTLPAALLLLFLALWLAASYGVRYGLMEDAQWVGLCAVPGEHWQCQVRSMLGLGIHFQ
VMAWAGLALALLAQVLGGRSGWWLAVLALVFSIPALVLYTASIAVFAVVLAGLRLVRQAR
RG
Download sequence
Identical sequences B1J1T2
390235.PputW619_1289 gi|170720475|ref|YP_001748163.1| WP_012313204.1.83615

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]