SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|170720756|ref|YP_001748444.1| from Pseudomonas putida W619

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|170720756|ref|YP_001748444.1|
Domain Number 1 Region: 7-179
Classification Level Classification E-value
Superfamily Transmembrane di-heme cytochromes 6.43e-29
Family Formate dehydrogenase N, cytochrome (gamma) subunit 0.062
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|170720756|ref|YP_001748444.1|
Sequence length 181
Comment cytochrome B561 [Pseudomonas putida W619]
Sequence
MVSSSPAPHYARLSIALHWLMLVLLAAVYACIELRGLFPKDSAERNLMKDLHFMLGLTVF
VLVWLRLAVRLVRPAPPIVPKPPAWQTGLAHVMHLALYLLMIGLPLAGWLILSAADKPVP
FYGLELPHLIAADPDLAKFIKGWHERVGSWGYWLIGLHALAGLYHHYVVRDNTLLRMLPY
K
Download sequence
Identical sequences B1J552
WP_012313478.1.83615 gi|170720756|ref|YP_001748444.1| 390235.PputW619_1570

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]