SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|170721570|ref|YP_001749258.1| from Pseudomonas putida W619

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|170721570|ref|YP_001749258.1|
Domain Number 1 Region: 3-175
Classification Level Classification E-value
Superfamily Transmembrane di-heme cytochromes 4.71e-33
Family Formate dehydrogenase N, cytochrome (gamma) subunit 0.057
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|170721570|ref|YP_001749258.1|
Sequence length 177
Comment cytochrome B561 [Pseudomonas putida W619]
Sequence
MKPEAFHPLARLVHWLMAILIIAMLFIGVSMVGDLSLRHPVLVELHKATGLGLLLLVIVR
IGLRLSLPHPPLPKDLPALQRLAAGASHLLLYALMLAMPLLGWAMLSAGGYPRPLQLPAI
APHDLQLYAMLRQAHGWAGYLLFATVLVHLGAALMHALVRRDGVLRSMWPGPLRRSD
Download sequence
Identical sequences B1J854
WP_012314249.1.83615 gi|170721570|ref|YP_001749258.1| 390235.PputW619_2389

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]