SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|170722473|ref|YP_001750161.1| from Pseudomonas putida W619

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|170722473|ref|YP_001750161.1|
Domain Number 1 Region: 6-179
Classification Level Classification E-value
Superfamily Transmembrane di-heme cytochromes 1.02e-31
Family Formate dehydrogenase N, cytochrome (gamma) subunit 0.043
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|170722473|ref|YP_001750161.1|
Sequence length 180
Comment cytochrome B561 [Pseudomonas putida W619]
Sequence
MKRDSTTDRYGRLSIIMHWSMVILFIGIYACIELRGALPRGSALKSPLLGIHALMGIAVF
ALVWVRLIGRLSPRPPILPKPPAWQAAMASVTHLALYGLMIVTPLLAWLMLGAEGKPLPY
WGMILPSPLPVDPALARTLKDWHELIGNAGYALIGLHACAGLAHHYLIKDNTLKRMLPGL
Download sequence
Identical sequences B1JAZ6
gi|170722473|ref|YP_001750161.1| 390235.PputW619_3307 WP_012315148.1.13533 WP_012315148.1.36333 WP_012315148.1.5613 WP_012315148.1.83267 WP_012315148.1.83615

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]