SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|170724323|ref|YP_001752011.1| from Pseudomonas putida W619

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  gi|170724323|ref|YP_001752011.1|
Domain Number - Region: 44-132
Classification Level Classification E-value
Superfamily Transmembrane di-heme cytochromes 0.0863
Family Formate dehydrogenase N, cytochrome (gamma) subunit 0.061
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|170724323|ref|YP_001752011.1|
Sequence length 146
Comment membrane protein [Pseudomonas putida W619]
Sequence
MFELTSYLGLFLAAFAAATLLPMQSEAALAAMLVSELYLPVALVAVATAGNVLGSVVNWF
LGRGVEHFKHKRWFPIRESKLEKAQVFYQRYGYWSLLLSWVPIIGDPITLVAGVMREPLW
RFTLLVTLAKGGRYLLLTLLVLGSMP
Download sequence
Identical sequences A0A0B5K7Q6 A0A0D1P842 B1JFQ8 R9V8B3
WP_012316918.1.14628 WP_012316918.1.17209 WP_012316918.1.54657 WP_012316918.1.57632 WP_012316918.1.59246 WP_012316918.1.68951 WP_012316918.1.80759 WP_012316918.1.83615 gi|170724323|ref|YP_001752011.1| 390235.PputW619_5166 gi|512580158|ref|YP_008098140.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]