SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|170719391|ref|YP_001747079.1| from Pseudomonas putida W619

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|170719391|ref|YP_001747079.1|
Domain Number 1 Region: 223-267,299-533
Classification Level Classification E-value
Superfamily NagB/RpiA/CoA transferase-like 3.43e-48
Family CoA transferase alpha subunit-like 0.0076
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|170719391|ref|YP_001747079.1|
Sequence length 619
Comment hypothetical protein PputW619_0204 [Pseudomonas putida W619]
Sequence
MHLCSIDQAVEQVLSRLPAHIHMGLPLGLGKPNAFVNALYARVRDLPERRLTIYTALSLG
RPPLGDGLQRRFLEPFIERVFADYQELTYLADLRNDQLPPNIRVEQFFMQPGGLLHSDCA
QQEYVSSNYSHAARDINAKGLNLIAQLVAATPERPVHLSLACNPDITLDLLPMIAKRREA
GETILMLGQVHAELPYMPGDSELGMEAFDLLIDQVEQSRLFSTPNMPVTTQDHCIGLHAS
TLVRDGGTLQIGIGAMGDAVAAALLARQGDNSGYRALMGELDVGPWQTLIEREGGLDAFG
QGLYGCSEMFVNGLLALAEAGVVRRPADEQGVLVHGGFFLGPQAFYQRLREMPLEQRAQF
AMTRISFINELYGQEELKRRQRRDARFINTVFTMTLLGAGVADQLEDGRVLSGVGGQYNF
VAQGHALEGGRSILLLRSWREAGGEVSSNLLWAYGHCTIPRHLRDIVVTEYGIADLRGQT
DSEVIARLLAISDSRFQGDLIEQAKQAGKLAKDFQLDARFTDNTPERLEQIRARHSRLFP
EYPLGTDFTAEERDLLRALSWLKSKFRLSEVLELGKAALDAPGPEGYAAQLARMQLDEPR
GLKEELYQRLLLAGLAATR
Download sequence
Identical sequences B1J4P7
WP_012312152.1.83615 390235.PputW619_0204 gi|170719391|ref|YP_001747079.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]