SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|166155466|ref|YP_001653721.1| from Chlamydia trachomatis L2b/UCH-1/proctitis

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|166155466|ref|YP_001653721.1|
Domain Number 1 Region: 6-256
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like II 4.15e-44
Family Phosphate binding protein-like 0.00035
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|166155466|ref|YP_001653721.1|
Sequence length 257
Comment arginine transport substrate-binding protein [Chlamydia trachomatis L2b/UCH-1/proctitis]
Sequence
MCIKRKKTWIAFLAVVCSFCLTGCLKEGGDSNSEKFIVGTNATYPPFEFVDKRGEVVGFD
IDLAREISNKLGKTLDVREFSFDALILNLKQHRIDAVITGMSITPSRLKEILMIPYYGEE
IKHLVLVFKGENKHPLPLTQYRSVAVQTGTYQEAYLQSLSEVHIRSFDSTLEVLMEVMHG
KSPVAVLEPSIAQVVLKDSPALSTATIDLPEDQWVLGYGIGVASDRPALALEIEAAVQEI
RKEGVLAELEQKWGLNN
Download sequence
Identical sequences A0A0E9G3L1 A0A0H3MC99
gi|478464340|ref|YP_007741032.1| gi|166154591|ref|YP_001654709.1| gi|478470648|ref|YP_007729289.1| gi|478448105|ref|YP_007722139.1| gi|527319122|ref|YP_008345323.1| 471472.CTL0636 471473.CTLon_0633 gi|527318201|ref|YP_008344403.1| gi|478452605|ref|YP_007720353.1| gi|482546690|ref|YP_007852606.1| gi|478462544|ref|YP_007738365.1| gi|166155466|ref|YP_001653721.1| gi|478467039|ref|YP_007718571.1| gi|527325910|ref|YP_008352103.1| gi|478447213|ref|YP_007715901.1| gi|478454410|ref|YP_007716789.1| gi|527326831|ref|YP_008353023.1| gi|527328683|ref|YP_008354873.1| gi|478449904|ref|YP_007719461.1| gi|478471539|ref|YP_007740142.1| gi|478465240|ref|YP_007741922.1| gi|339626053|ref|YP_004717532.1| gi|478463443|ref|YP_007739255.1| gi|478453518|ref|YP_007717680.1| gi|478467940|ref|YP_007742813.1| gi|527324985|ref|YP_008351179.1| gi|482545747|ref|YP_007851665.1| gi|478450805|ref|YP_007721247.1| gi|527321948|ref|YP_008348146.1| WP_009873772.1.100883 WP_009873772.1.101735 WP_009873772.1.11732 WP_009873772.1.17082 WP_009873772.1.18643 WP_009873772.1.22210 WP_009873772.1.25195 WP_009873772.1.27753 WP_009873772.1.27980 WP_009873772.1.32801 WP_009873772.1.38181 WP_009873772.1.38794 WP_009873772.1.40464 WP_009873772.1.40808 WP_009873772.1.42718 WP_009873772.1.45552 WP_009873772.1.48923 WP_009873772.1.49465 WP_009873772.1.51159 WP_009873772.1.53299 WP_009873772.1.5416 WP_009873772.1.58046 WP_009873772.1.58308 WP_009873772.1.5967 WP_009873772.1.60427 WP_009873772.1.61004 WP_009873772.1.62489 WP_009873772.1.64162 WP_009873772.1.67104 WP_009873772.1.71307 WP_009873772.1.79775 WP_009873772.1.83642 WP_009873772.1.85365 WP_009873772.1.95142 WP_009873772.1.97423 WP_009873772.1.99598 YP_001654709.1.27483 gi|527327758|ref|YP_008353949.1| gi|478469749|ref|YP_007723029.1| gi|478451705|ref|YP_007715011.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]