SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|194443128|ref|YP_002040156.1| from Salmonella enterica subsp. enterica serovar Newport str. SL254

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|194443128|ref|YP_002040156.1|
Domain Number 1 Region: 2-315
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 7.48e-54
Family FAD/NAD-linked reductases, N-terminal and central domains 0.00000104
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|194443128|ref|YP_002040156.1|
Sequence length 322
Comment thioredoxin reductase [Salmonella enterica subsp. enterica serovar Newport str. SL254]
Sequence
MGTTKHSKLLILGSGPAGYTAAVYAARANLQPVLITGMEKGGQLTTTTEVENWPGDPNDL
TGPLLMERMHEHAAKFETEIIFDHINKVDLQNRPFRLTGDSAEYTCDALIIATGASARYL
GLPSEEAFKGRGVSACATCDGFFYRNQKVAVIGGGNTAVEEALYLSNIASEVHLIHRRDG
FRAEKILIKRLMDKVENGNIILHTNRTLEEVTGDQMGVTGLRLRDTQQSDNIETLDIAGL
FVAIGHSPNTALFEGQLELENGYIKVQSGTHGNATQTSIPGVFAAGDVMDHIYRQAITSA
GTGCMAALDAERYLDGLADASK
Download sequence
Identical sequences A0A0H3BMN5 A0A0L3JH12 A0A0M0PK12 A0A0N1QVH6 A0A0R9MR72 A0A0T7RSY3 A0A1S1AM54 A0A1U7FNH3 A0A1X2UVI9 A0A1X2Y501 A0A221YJ88 A0A221Z1S7 A0A249V089 A0A267SEL5 A0A271CBI0 A0A271CWY3 A0A2C9P1L9 A0A2D1XFS9 A0A2D1XTP9 A0A2G1P8Z8 A0A2I6MA92 A0A2I6MMY6 A0A2I6N149 A0A2I6NF81 A0A2I6NT29 G4C032 G5RDG7 G5S9J7 S5HJS1 V7IPK8
gi|525857184|ref|YP_008260146.1| gi|528818686|ref|YP_008359889.1| WP_000537406.1.100031 WP_000537406.1.100129 WP_000537406.1.100137 WP_000537406.1.1002 WP_000537406.1.100258 WP_000537406.1.100438 WP_000537406.1.100502 WP_000537406.1.100521 WP_000537406.1.100584 WP_000537406.1.10065 WP_000537406.1.100707 WP_000537406.1.100711 WP_000537406.1.10074 WP_000537406.1.100750 WP_000537406.1.100865 WP_000537406.1.100886 WP_000537406.1.100944 WP_000537406.1.100948 WP_000537406.1.101042 WP_000537406.1.101091 WP_000537406.1.101094 WP_000537406.1.101123 WP_000537406.1.101126 WP_000537406.1.101147 WP_000537406.1.101199 WP_000537406.1.101320 WP_000537406.1.101425 WP_000537406.1.101454 WP_000537406.1.101473 WP_000537406.1.101519 WP_000537406.1.101609 WP_000537406.1.101636 WP_000537406.1.101639 WP_000537406.1.10164 WP_000537406.1.101666 WP_000537406.1.101740 WP_000537406.1.101741 WP_000537406.1.101759 WP_000537406.1.10177 WP_000537406.1.101815 WP_000537406.1.101839 WP_000537406.1.101868 WP_000537406.1.101975 WP_000537406.1.102009 WP_000537406.1.10276 WP_000537406.1.10293 WP_000537406.1.10310 WP_000537406.1.10394 WP_000537406.1.10562 WP_000537406.1.10568 WP_000537406.1.10675 WP_000537406.1.10711 WP_000537406.1.11000 WP_000537406.1.11213 WP_000537406.1.11254 WP_000537406.1.11304 WP_000537406.1.1135 WP_000537406.1.11362 WP_000537406.1.1137 WP_000537406.1.11444 WP_000537406.1.11681 WP_000537406.1.11865 WP_000537406.1.11868 WP_000537406.1.11875 WP_000537406.1.11936 WP_000537406.1.11964 WP_000537406.1.12007 WP_000537406.1.12025 WP_000537406.1.12144 WP_000537406.1.12159 WP_000537406.1.12280 WP_000537406.1.12396 WP_000537406.1.12397 WP_000537406.1.12456 WP_000537406.1.12472 WP_000537406.1.12484 WP_000537406.1.1250 WP_000537406.1.12701 WP_000537406.1.12864 WP_000537406.1.12877 WP_000537406.1.1299 WP_000537406.1.13101 WP_000537406.1.1326 WP_000537406.1.13311 WP_000537406.1.13334 WP_000537406.1.13528 WP_000537406.1.13543 WP_000537406.1.13677 WP_000537406.1.13750 WP_000537406.1.13764 WP_000537406.1.13799 WP_000537406.1.13827 WP_000537406.1.13848 WP_000537406.1.13857 WP_000537406.1.14050 WP_000537406.1.14056 WP_000537406.1.14296 WP_000537406.1.14369 WP_000537406.1.1440 WP_000537406.1.14446 WP_000537406.1.14495 WP_000537406.1.14505 WP_000537406.1.14688 WP_000537406.1.14737 WP_000537406.1.14789 WP_000537406.1.14808 WP_000537406.1.14876 WP_000537406.1.14884 WP_000537406.1.14917 WP_000537406.1.14927 WP_000537406.1.14964 WP_000537406.1.15046 WP_000537406.1.15054 WP_000537406.1.15059 WP_000537406.1.15079 WP_000537406.1.15100 WP_000537406.1.15102 WP_000537406.1.15353 WP_000537406.1.15483 WP_000537406.1.1551 WP_000537406.1.15586 WP_000537406.1.15612 WP_000537406.1.15616 WP_000537406.1.15625 WP_000537406.1.15627 WP_000537406.1.15708 WP_000537406.1.15909 WP_000537406.1.1592 WP_000537406.1.15922 WP_000537406.1.16032 WP_000537406.1.1611 WP_000537406.1.16125 WP_000537406.1.16172 WP_000537406.1.16273 WP_000537406.1.16331 WP_000537406.1.16508 WP_000537406.1.16551 WP_000537406.1.16581 WP_000537406.1.1668 WP_000537406.1.167 WP_000537406.1.16804 WP_000537406.1.16817 WP_000537406.1.16846 WP_000537406.1.16855 WP_000537406.1.1689 WP_000537406.1.16910 WP_000537406.1.16941 WP_000537406.1.16942 WP_000537406.1.16998 WP_000537406.1.17031 WP_000537406.1.17098 WP_000537406.1.17188 WP_000537406.1.17270 WP_000537406.1.17285 WP_000537406.1.1737 WP_000537406.1.17447 WP_000537406.1.1749 WP_000537406.1.17504 WP_000537406.1.1757 WP_000537406.1.17629 WP_000537406.1.17693 WP_000537406.1.17703 WP_000537406.1.17747 WP_000537406.1.17755 WP_000537406.1.17919 WP_000537406.1.17991 WP_000537406.1.18103 WP_000537406.1.1814 WP_000537406.1.18177 WP_000537406.1.18192 WP_000537406.1.18249 WP_000537406.1.1825 WP_000537406.1.18277 WP_000537406.1.18281 WP_000537406.1.18282 WP_000537406.1.18365 WP_000537406.1.18426 WP_000537406.1.18441 WP_000537406.1.18485 WP_000537406.1.18692 WP_000537406.1.18895 WP_000537406.1.1897 WP_000537406.1.19030 WP_000537406.1.19038 WP_000537406.1.19064 WP_000537406.1.19163 WP_000537406.1.19174 WP_000537406.1.19240 WP_000537406.1.19291 WP_000537406.1.19340 WP_000537406.1.19357 WP_000537406.1.1939 WP_000537406.1.19405 WP_000537406.1.1954 WP_000537406.1.19642 WP_000537406.1.1968 WP_000537406.1.19683 WP_000537406.1.19740 WP_000537406.1.19863 WP_000537406.1.19884 WP_000537406.1.19967 WP_000537406.1.19987 WP_000537406.1.20091 WP_000537406.1.20119 WP_000537406.1.20218 WP_000537406.1.20330 WP_000537406.1.20349 WP_000537406.1.20391 WP_000537406.1.20415 WP_000537406.1.20425 WP_000537406.1.20488 WP_000537406.1.20503 WP_000537406.1.20695 WP_000537406.1.20700 WP_000537406.1.20789 WP_000537406.1.20810 WP_000537406.1.20839 WP_000537406.1.20862 WP_000537406.1.20900 WP_000537406.1.21075 WP_000537406.1.21089 WP_000537406.1.21260 WP_000537406.1.21286 WP_000537406.1.2130 WP_000537406.1.21399 WP_000537406.1.21423 WP_000537406.1.21443 WP_000537406.1.2146 WP_000537406.1.21473 WP_000537406.1.21548 WP_000537406.1.21692 WP_000537406.1.21792 WP_000537406.1.21825 WP_000537406.1.21877 WP_000537406.1.21886 WP_000537406.1.21910 WP_000537406.1.21940 WP_000537406.1.21981 WP_000537406.1.22030 WP_000537406.1.22069 WP_000537406.1.22205 WP_000537406.1.22337 WP_000537406.1.22388 WP_000537406.1.22514 WP_000537406.1.22537 WP_000537406.1.22565 WP_000537406.1.22575 WP_000537406.1.22582 WP_000537406.1.22676 WP_000537406.1.22966 WP_000537406.1.23053 WP_000537406.1.23155 WP_000537406.1.23172 WP_000537406.1.23175 WP_000537406.1.23201 WP_000537406.1.23274 WP_000537406.1.23279 WP_000537406.1.23309 WP_000537406.1.23311 WP_000537406.1.23343 WP_000537406.1.23500 WP_000537406.1.23513 WP_000537406.1.23529 WP_000537406.1.23621 WP_000537406.1.23639 WP_000537406.1.23646 WP_000537406.1.23670 WP_000537406.1.237 WP_000537406.1.23720 WP_000537406.1.23736 WP_000537406.1.23755 WP_000537406.1.2380 WP_000537406.1.23819 WP_000537406.1.24376 WP_000537406.1.24412 WP_000537406.1.24444 WP_000537406.1.24521 WP_000537406.1.24555 WP_000537406.1.24567 WP_000537406.1.24686 WP_000537406.1.24689 WP_000537406.1.24723 WP_000537406.1.24839 WP_000537406.1.24995 WP_000537406.1.25036 WP_000537406.1.25064 WP_000537406.1.25072 WP_000537406.1.25130 WP_000537406.1.25206 WP_000537406.1.25217 WP_000537406.1.25297 WP_000537406.1.25397 WP_000537406.1.25498 WP_000537406.1.2554 WP_000537406.1.25546 WP_000537406.1.25700 WP_000537406.1.25708 WP_000537406.1.25809 WP_000537406.1.2581 WP_000537406.1.25825 WP_000537406.1.25928 WP_000537406.1.25932 WP_000537406.1.26034 WP_000537406.1.26075 WP_000537406.1.26213 WP_000537406.1.26269 WP_000537406.1.26363 WP_000537406.1.26426 WP_000537406.1.26512 WP_000537406.1.26563 WP_000537406.1.26576 WP_000537406.1.26582 WP_000537406.1.26758 WP_000537406.1.26787 WP_000537406.1.26833 WP_000537406.1.26856 WP_000537406.1.26882 WP_000537406.1.26892 WP_000537406.1.26980 WP_000537406.1.27051 WP_000537406.1.27072 WP_000537406.1.27122 WP_000537406.1.27255 WP_000537406.1.27419 WP_000537406.1.27452 WP_000537406.1.27523 WP_000537406.1.27535 WP_000537406.1.27655 WP_000537406.1.27713 WP_000537406.1.27755 WP_000537406.1.27776 WP_000537406.1.27798 WP_000537406.1.2806 WP_000537406.1.28073 WP_000537406.1.28126 WP_000537406.1.28174 WP_000537406.1.28225 WP_000537406.1.28267 WP_000537406.1.2829 WP_000537406.1.28301 WP_000537406.1.28393 WP_000537406.1.28504 WP_000537406.1.28612 WP_000537406.1.28673 WP_000537406.1.287 WP_000537406.1.28775 WP_000537406.1.28776 WP_000537406.1.28902 WP_000537406.1.28921 WP_000537406.1.28948 WP_000537406.1.28963 WP_000537406.1.29099 WP_000537406.1.29174 WP_000537406.1.29255 WP_000537406.1.29349 WP_000537406.1.29593 WP_000537406.1.29924 WP_000537406.1.30018 WP_000537406.1.3017 WP_000537406.1.30170 WP_000537406.1.30195 WP_000537406.1.30225 WP_000537406.1.30238 WP_000537406.1.30386 WP_000537406.1.30389 WP_000537406.1.30425 WP_000537406.1.30437 WP_000537406.1.30602 WP_000537406.1.30635 WP_000537406.1.3066 WP_000537406.1.3068 WP_000537406.1.3080 WP_000537406.1.30803 WP_000537406.1.30819 WP_000537406.1.30823 WP_000537406.1.3089 WP_000537406.1.30909 WP_000537406.1.3095 WP_000537406.1.30951 WP_000537406.1.31001 WP_000537406.1.31011 WP_000537406.1.31042 WP_000537406.1.31111 WP_000537406.1.3114 WP_000537406.1.31171 WP_000537406.1.31198 WP_000537406.1.31210 WP_000537406.1.31219 WP_000537406.1.3124 WP_000537406.1.31251 WP_000537406.1.3127 WP_000537406.1.31476 WP_000537406.1.31665 WP_000537406.1.3170 WP_000537406.1.31720 WP_000537406.1.31725 WP_000537406.1.3185 WP_000537406.1.31854 WP_000537406.1.31927 WP_000537406.1.31952 WP_000537406.1.32006 WP_000537406.1.32056 WP_000537406.1.32170 WP_000537406.1.32277 WP_000537406.1.32357 WP_000537406.1.32368 WP_000537406.1.32408 WP_000537406.1.32424 WP_000537406.1.32491 WP_000537406.1.32527 WP_000537406.1.32545 WP_000537406.1.32624 WP_000537406.1.32629 WP_000537406.1.32643 WP_000537406.1.32860 WP_000537406.1.32930 WP_000537406.1.3304 WP_000537406.1.3310 WP_000537406.1.33106 WP_000537406.1.33114 WP_000537406.1.33144 WP_000537406.1.33160 WP_000537406.1.33486 WP_000537406.1.33499 WP_000537406.1.33659 WP_000537406.1.33693 WP_000537406.1.33817 WP_000537406.1.33986 WP_000537406.1.34022 WP_000537406.1.34081 WP_000537406.1.34107 WP_000537406.1.34184 WP_000537406.1.34259 WP_000537406.1.34304 WP_000537406.1.3445 WP_000537406.1.34458 WP_000537406.1.34659 WP_000537406.1.34703 WP_000537406.1.34707 WP_000537406.1.34801 WP_000537406.1.34817 WP_000537406.1.34854 WP_000537406.1.34972 WP_000537406.1.34977 WP_000537406.1.3541 WP_000537406.1.35429 WP_000537406.1.35460 WP_000537406.1.35494 WP_000537406.1.35648 WP_000537406.1.35868 WP_000537406.1.35993 WP_000537406.1.3610 WP_000537406.1.36157 WP_000537406.1.36172 WP_000537406.1.36236 WP_000537406.1.36286 WP_000537406.1.36512 WP_000537406.1.36564 WP_000537406.1.36652 WP_000537406.1.36839 WP_000537406.1.37013 WP_000537406.1.37028 WP_000537406.1.37100 WP_000537406.1.37190 WP_000537406.1.37267 WP_000537406.1.3734 WP_000537406.1.37351 WP_000537406.1.37478 WP_000537406.1.3751 WP_000537406.1.37521 WP_000537406.1.37558 WP_000537406.1.37610 WP_000537406.1.37666 WP_000537406.1.37687 WP_000537406.1.37965 WP_000537406.1.38026 WP_000537406.1.38199 WP_000537406.1.38322 WP_000537406.1.38349 WP_000537406.1.38512 WP_000537406.1.38609 WP_000537406.1.38622 WP_000537406.1.3869 WP_000537406.1.38830 WP_000537406.1.38898 WP_000537406.1.3891 WP_000537406.1.39059 WP_000537406.1.39082 WP_000537406.1.39113 WP_000537406.1.39128 WP_000537406.1.39140 WP_000537406.1.39275 WP_000537406.1.39311 WP_000537406.1.39471 WP_000537406.1.39503 WP_000537406.1.39556 WP_000537406.1.39609 WP_000537406.1.39808 WP_000537406.1.40025 WP_000537406.1.40224 WP_000537406.1.40229 WP_000537406.1.40258 WP_000537406.1.40492 WP_000537406.1.40508 WP_000537406.1.40605 WP_000537406.1.40693 WP_000537406.1.40722 WP_000537406.1.40771 WP_000537406.1.40788 WP_000537406.1.40979 WP_000537406.1.41048 WP_000537406.1.41050 WP_000537406.1.41299 WP_000537406.1.41310 WP_000537406.1.41440 WP_000537406.1.41468 WP_000537406.1.41735 WP_000537406.1.41859 WP_000537406.1.41862 WP_000537406.1.41877 WP_000537406.1.41897 WP_000537406.1.41904 WP_000537406.1.41931 WP_000537406.1.41938 WP_000537406.1.42109 WP_000537406.1.42244 WP_000537406.1.42248 WP_000537406.1.42276 WP_000537406.1.42328 WP_000537406.1.42356 WP_000537406.1.4239 WP_000537406.1.42404 WP_000537406.1.42433 WP_000537406.1.42491 WP_000537406.1.4257 WP_000537406.1.42655 WP_000537406.1.42707 WP_000537406.1.42794 WP_000537406.1.42797 WP_000537406.1.42829 WP_000537406.1.42861 WP_000537406.1.42887 WP_000537406.1.4289 WP_000537406.1.42923 WP_000537406.1.42978 WP_000537406.1.42981 WP_000537406.1.43126 WP_000537406.1.43149 WP_000537406.1.43160 WP_000537406.1.43258 WP_000537406.1.43276 WP_000537406.1.43299 WP_000537406.1.43351 WP_000537406.1.43438 WP_000537406.1.43441 WP_000537406.1.43476 WP_000537406.1.43520 WP_000537406.1.43535 WP_000537406.1.43606 WP_000537406.1.43654 WP_000537406.1.43710 WP_000537406.1.43782 WP_000537406.1.43839 WP_000537406.1.43873 WP_000537406.1.43875 WP_000537406.1.4405 WP_000537406.1.44191 WP_000537406.1.44250 WP_000537406.1.44339 WP_000537406.1.4440 WP_000537406.1.44438 WP_000537406.1.44440 WP_000537406.1.44549 WP_000537406.1.44578 WP_000537406.1.44607 WP_000537406.1.44781 WP_000537406.1.44795 WP_000537406.1.449 WP_000537406.1.44950 WP_000537406.1.44971 WP_000537406.1.44985 WP_000537406.1.44998 WP_000537406.1.45038 WP_000537406.1.45123 WP_000537406.1.45154 WP_000537406.1.45229 WP_000537406.1.45322 WP_000537406.1.45344 WP_000537406.1.4540 WP_000537406.1.45402 WP_000537406.1.45462 WP_000537406.1.45468 WP_000537406.1.45522 WP_000537406.1.45535 WP_000537406.1.45544 WP_000537406.1.45781 WP_000537406.1.45797 WP_000537406.1.45984 WP_000537406.1.46091 WP_000537406.1.46124 WP_000537406.1.46203 WP_000537406.1.46205 WP_000537406.1.46232 WP_000537406.1.46243 WP_000537406.1.46299 WP_000537406.1.46322 WP_000537406.1.46323 WP_000537406.1.46444 WP_000537406.1.46499 WP_000537406.1.46572 WP_000537406.1.46620 WP_000537406.1.46693 WP_000537406.1.4671 WP_000537406.1.46730 WP_000537406.1.46732 WP_000537406.1.46749 WP_000537406.1.46930 WP_000537406.1.46961 WP_000537406.1.47005 WP_000537406.1.47058 WP_000537406.1.47067 WP_000537406.1.47389 WP_000537406.1.47442 WP_000537406.1.47482 WP_000537406.1.47492 WP_000537406.1.47506 WP_000537406.1.4770 WP_000537406.1.47714 WP_000537406.1.4775 WP_000537406.1.47849 WP_000537406.1.47928 WP_000537406.1.48215 WP_000537406.1.48218 WP_000537406.1.48247 WP_000537406.1.48262 WP_000537406.1.48493 WP_000537406.1.48647 WP_000537406.1.48774 WP_000537406.1.48855 WP_000537406.1.48908 WP_000537406.1.48918 WP_000537406.1.48931 WP_000537406.1.49005 WP_000537406.1.49012 WP_000537406.1.49090 WP_000537406.1.49102 WP_000537406.1.49175 WP_000537406.1.49226 WP_000537406.1.49262 WP_000537406.1.49309 WP_000537406.1.49358 WP_000537406.1.49443 WP_000537406.1.49574 WP_000537406.1.49602 WP_000537406.1.49780 WP_000537406.1.49827 WP_000537406.1.49848 WP_000537406.1.49931 WP_000537406.1.50 WP_000537406.1.50007 WP_000537406.1.5009 WP_000537406.1.50198 WP_000537406.1.50238 WP_000537406.1.50251 WP_000537406.1.50285 WP_000537406.1.50374 WP_000537406.1.50386 WP_000537406.1.50413 WP_000537406.1.50478 WP_000537406.1.5058 WP_000537406.1.50593 WP_000537406.1.50811 WP_000537406.1.50893 WP_000537406.1.50918 WP_000537406.1.50954 WP_000537406.1.51162 WP_000537406.1.51285 WP_000537406.1.51331 WP_000537406.1.51338 WP_000537406.1.51394 WP_000537406.1.51414 WP_000537406.1.51419 WP_000537406.1.51464 WP_000537406.1.51506 WP_000537406.1.51514 WP_000537406.1.51555 WP_000537406.1.51594 WP_000537406.1.51611 WP_000537406.1.51613 WP_000537406.1.51615 WP_000537406.1.51700 WP_000537406.1.51841 WP_000537406.1.51888 WP_000537406.1.51914 WP_000537406.1.52123 WP_000537406.1.52148 WP_000537406.1.52156 WP_000537406.1.52161 WP_000537406.1.52456 WP_000537406.1.52528 WP_000537406.1.52608 WP_000537406.1.52744 WP_000537406.1.52748 WP_000537406.1.52824 WP_000537406.1.52858 WP_000537406.1.52924 WP_000537406.1.53100 WP_000537406.1.53158 WP_000537406.1.5316 WP_000537406.1.53203 WP_000537406.1.53316 WP_000537406.1.53328 WP_000537406.1.5333 WP_000537406.1.53436 WP_000537406.1.53534 WP_000537406.1.53688 WP_000537406.1.53694 WP_000537406.1.54061 WP_000537406.1.54082 WP_000537406.1.54159 WP_000537406.1.542 WP_000537406.1.54273 WP_000537406.1.54333 WP_000537406.1.54500 WP_000537406.1.54522 WP_000537406.1.54558 WP_000537406.1.5456 WP_000537406.1.5459 WP_000537406.1.54607 WP_000537406.1.54694 WP_000537406.1.54814 WP_000537406.1.54822 WP_000537406.1.54827 WP_000537406.1.54845 WP_000537406.1.5493 WP_000537406.1.54984 WP_000537406.1.54992 WP_000537406.1.55073 WP_000537406.1.5517 WP_000537406.1.55223 WP_000537406.1.55224 WP_000537406.1.5523 WP_000537406.1.5525 WP_000537406.1.55361 WP_000537406.1.55461 WP_000537406.1.55477 WP_000537406.1.55496 WP_000537406.1.55545 WP_000537406.1.5555 WP_000537406.1.55554 WP_000537406.1.55557 WP_000537406.1.55614 WP_000537406.1.55623 WP_000537406.1.55672 WP_000537406.1.55706 WP_000537406.1.55718 WP_000537406.1.55993 WP_000537406.1.56026 WP_000537406.1.56069 WP_000537406.1.56097 WP_000537406.1.56130 WP_000537406.1.56152 WP_000537406.1.56247 WP_000537406.1.56261 WP_000537406.1.56303 WP_000537406.1.56354 WP_000537406.1.56370 WP_000537406.1.56385 WP_000537406.1.56393 WP_000537406.1.56413 WP_000537406.1.56615 WP_000537406.1.56642 WP_000537406.1.56647 WP_000537406.1.56651 WP_000537406.1.57000 WP_000537406.1.57084 WP_000537406.1.57125 WP_000537406.1.57149 WP_000537406.1.57232 WP_000537406.1.57233 WP_000537406.1.57357 WP_000537406.1.57494 WP_000537406.1.57495 WP_000537406.1.57534 WP_000537406.1.57709 WP_000537406.1.57735 WP_000537406.1.5781 WP_000537406.1.57857 WP_000537406.1.58153 WP_000537406.1.58249 WP_000537406.1.58251 WP_000537406.1.58301 WP_000537406.1.58334 WP_000537406.1.58357 WP_000537406.1.58372 WP_000537406.1.58442 WP_000537406.1.5846 WP_000537406.1.5854 WP_000537406.1.58564 WP_000537406.1.58698 WP_000537406.1.58729 WP_000537406.1.58834 WP_000537406.1.58836 WP_000537406.1.59125 WP_000537406.1.59136 WP_000537406.1.59148 WP_000537406.1.59412 WP_000537406.1.59521 WP_000537406.1.5953 WP_000537406.1.59604 WP_000537406.1.59636 WP_000537406.1.59709 WP_000537406.1.59710 WP_000537406.1.59755 WP_000537406.1.59928 WP_000537406.1.59933 WP_000537406.1.60015 WP_000537406.1.60052 WP_000537406.1.60209 WP_000537406.1.60213 WP_000537406.1.60226 WP_000537406.1.60231 WP_000537406.1.60330 WP_000537406.1.60370 WP_000537406.1.60469 WP_000537406.1.60507 WP_000537406.1.60746 WP_000537406.1.60794 WP_000537406.1.60838 WP_000537406.1.6086 WP_000537406.1.6090 WP_000537406.1.60926 WP_000537406.1.60976 WP_000537406.1.60988 WP_000537406.1.60990 WP_000537406.1.61045 WP_000537406.1.61087 WP_000537406.1.61114 WP_000537406.1.61184 WP_000537406.1.61200 WP_000537406.1.61233 WP_000537406.1.61434 WP_000537406.1.61497 WP_000537406.1.61582 WP_000537406.1.61609 WP_000537406.1.61662 WP_000537406.1.61737 WP_000537406.1.61743 WP_000537406.1.61968 WP_000537406.1.6210 WP_000537406.1.62108 WP_000537406.1.62120 WP_000537406.1.62122 WP_000537406.1.62184 WP_000537406.1.62219 WP_000537406.1.62241 WP_000537406.1.62271 WP_000537406.1.62310 WP_000537406.1.62339 WP_000537406.1.62344 WP_000537406.1.62361 WP_000537406.1.62404 WP_000537406.1.62486 WP_000537406.1.62488 WP_000537406.1.62522 WP_000537406.1.62570 WP_000537406.1.62677 WP_000537406.1.62725 WP_000537406.1.62798 WP_000537406.1.62828 WP_000537406.1.62976 WP_000537406.1.63043 WP_000537406.1.63063 WP_000537406.1.63118 WP_000537406.1.63129 WP_000537406.1.63135 WP_000537406.1.63150 WP_000537406.1.63155 WP_000537406.1.63186 WP_000537406.1.63234 WP_000537406.1.63243 WP_000537406.1.63250 WP_000537406.1.63455 WP_000537406.1.63499 WP_000537406.1.63513 WP_000537406.1.63525 WP_000537406.1.63532 WP_000537406.1.6357 WP_000537406.1.6367 WP_000537406.1.63766 WP_000537406.1.63781 WP_000537406.1.63782 WP_000537406.1.63824 WP_000537406.1.63831 WP_000537406.1.63864 WP_000537406.1.63903 WP_000537406.1.63977 WP_000537406.1.6399 WP_000537406.1.63992 WP_000537406.1.64208 WP_000537406.1.64217 WP_000537406.1.64242 WP_000537406.1.6437 WP_000537406.1.64374 WP_000537406.1.64389 WP_000537406.1.64569 WP_000537406.1.64645 WP_000537406.1.64690 WP_000537406.1.64798 WP_000537406.1.64972 WP_000537406.1.65052 WP_000537406.1.65168 WP_000537406.1.65185 WP_000537406.1.65238 WP_000537406.1.6525 WP_000537406.1.65295 WP_000537406.1.65348 WP_000537406.1.65363 WP_000537406.1.65437 WP_000537406.1.65572 WP_000537406.1.6561 WP_000537406.1.65687 WP_000537406.1.6572 WP_000537406.1.65838 WP_000537406.1.65849 WP_000537406.1.65876 WP_000537406.1.65968 WP_000537406.1.66074 WP_000537406.1.66082 WP_000537406.1.66085 WP_000537406.1.66129 WP_000537406.1.66167 WP_000537406.1.66235 WP_000537406.1.66365 WP_000537406.1.66368 WP_000537406.1.66492 WP_000537406.1.66534 WP_000537406.1.66600 WP_000537406.1.66630 WP_000537406.1.66779 WP_000537406.1.66800 WP_000537406.1.66825 WP_000537406.1.67 WP_000537406.1.67175 WP_000537406.1.67184 WP_000537406.1.67374 WP_000537406.1.67424 WP_000537406.1.67603 WP_000537406.1.67617 WP_000537406.1.67633 WP_000537406.1.67707 WP_000537406.1.67731 WP_000537406.1.67772 WP_000537406.1.67803 WP_000537406.1.67827 WP_000537406.1.67905 WP_000537406.1.67970 WP_000537406.1.67988 WP_000537406.1.68036 WP_000537406.1.6809 WP_000537406.1.68115 WP_000537406.1.68167 WP_000537406.1.6833 WP_000537406.1.68591 WP_000537406.1.68629 WP_000537406.1.6869 WP_000537406.1.6879 WP_000537406.1.68816 WP_000537406.1.68818 WP_000537406.1.6882 WP_000537406.1.68999 WP_000537406.1.6907 WP_000537406.1.69139 WP_000537406.1.69288 WP_000537406.1.69296 WP_000537406.1.69320 WP_000537406.1.69385 WP_000537406.1.69588 WP_000537406.1.69597 WP_000537406.1.69696 WP_000537406.1.69710 WP_000537406.1.69754 WP_000537406.1.69760 WP_000537406.1.69785 WP_000537406.1.69790 WP_000537406.1.69807 WP_000537406.1.69808 WP_000537406.1.69848 WP_000537406.1.69975 WP_000537406.1.69982 WP_000537406.1.70047 WP_000537406.1.70087 WP_000537406.1.7010 WP_000537406.1.7014 WP_000537406.1.7016 WP_000537406.1.70183 WP_000537406.1.70281 WP_000537406.1.70290 WP_000537406.1.70326 WP_000537406.1.70355 WP_000537406.1.7044 WP_000537406.1.70523 WP_000537406.1.70547 WP_000537406.1.7055 WP_000537406.1.70644 WP_000537406.1.70792 WP_000537406.1.70797 WP_000537406.1.70869 WP_000537406.1.70914 WP_000537406.1.7093 WP_000537406.1.70971 WP_000537406.1.70986 WP_000537406.1.71007 WP_000537406.1.71010 WP_000537406.1.71069 WP_000537406.1.71088 WP_000537406.1.71120 WP_000537406.1.71248 WP_000537406.1.71268 WP_000537406.1.71368 WP_000537406.1.7142 WP_000537406.1.71450 WP_000537406.1.71452 WP_000537406.1.71583 WP_000537406.1.71667 WP_000537406.1.71691 WP_000537406.1.71746 WP_000537406.1.71923 WP_000537406.1.71929 WP_000537406.1.71941 WP_000537406.1.72065 WP_000537406.1.72220 WP_000537406.1.72283 WP_000537406.1.72307 WP_000537406.1.72372 WP_000537406.1.7243 WP_000537406.1.72438 WP_000537406.1.72642 WP_000537406.1.72827 WP_000537406.1.72843 WP_000537406.1.72850 WP_000537406.1.72872 WP_000537406.1.72944 WP_000537406.1.72968 WP_000537406.1.7304 WP_000537406.1.73062 WP_000537406.1.73144 WP_000537406.1.73164 WP_000537406.1.73328 WP_000537406.1.7341 WP_000537406.1.73512 WP_000537406.1.73561 WP_000537406.1.73596 WP_000537406.1.73667 WP_000537406.1.73669 WP_000537406.1.73701 WP_000537406.1.7374 WP_000537406.1.73901 WP_000537406.1.73926 WP_000537406.1.7394 WP_000537406.1.73945 WP_000537406.1.73956 WP_000537406.1.73965 WP_000537406.1.74028 WP_000537406.1.74040 WP_000537406.1.7405 WP_000537406.1.74228 WP_000537406.1.74422 WP_000537406.1.74428 WP_000537406.1.7444 WP_000537406.1.74469 WP_000537406.1.74570 WP_000537406.1.7458 WP_000537406.1.74620 WP_000537406.1.74632 WP_000537406.1.74661 WP_000537406.1.74757 WP_000537406.1.74806 WP_000537406.1.74807 WP_000537406.1.74876 WP_000537406.1.74946 WP_000537406.1.74992 WP_000537406.1.74996 WP_000537406.1.75009 WP_000537406.1.75058 WP_000537406.1.75114 WP_000537406.1.75168 WP_000537406.1.75177 WP_000537406.1.7531 WP_000537406.1.75609 WP_000537406.1.75664 WP_000537406.1.75793 WP_000537406.1.75828 WP_000537406.1.75884 WP_000537406.1.75932 WP_000537406.1.75957 WP_000537406.1.76 WP_000537406.1.76024 WP_000537406.1.76055 WP_000537406.1.76102 WP_000537406.1.76156 WP_000537406.1.76164 WP_000537406.1.76170 WP_000537406.1.76186 WP_000537406.1.76197 WP_000537406.1.76208 WP_000537406.1.7629 WP_000537406.1.7633 WP_000537406.1.76346 WP_000537406.1.76434 WP_000537406.1.76471 WP_000537406.1.76529 WP_000537406.1.76532 WP_000537406.1.76548 WP_000537406.1.7655 WP_000537406.1.76576 WP_000537406.1.76611 WP_000537406.1.7672 WP_000537406.1.76724 WP_000537406.1.76738 WP_000537406.1.77184 WP_000537406.1.77193 WP_000537406.1.77271 WP_000537406.1.77390 WP_000537406.1.77431 WP_000537406.1.77440 WP_000537406.1.77543 WP_000537406.1.77555 WP_000537406.1.77596 WP_000537406.1.77629 WP_000537406.1.77971 WP_000537406.1.77987 WP_000537406.1.78016 WP_000537406.1.78168 WP_000537406.1.78245 WP_000537406.1.78259 WP_000537406.1.78301 WP_000537406.1.78502 WP_000537406.1.78602 WP_000537406.1.78738 WP_000537406.1.78771 WP_000537406.1.78789 WP_000537406.1.78862 WP_000537406.1.7891 WP_000537406.1.78913 WP_000537406.1.78928 WP_000537406.1.7893 WP_000537406.1.79011 WP_000537406.1.79032 WP_000537406.1.79081 WP_000537406.1.79203 WP_000537406.1.79297 WP_000537406.1.79370 WP_000537406.1.79427 WP_000537406.1.7956 WP_000537406.1.79635 WP_000537406.1.79642 WP_000537406.1.7972 WP_000537406.1.79832 WP_000537406.1.79867 WP_000537406.1.79934 WP_000537406.1.79945 WP_000537406.1.80229 WP_000537406.1.8024 WP_000537406.1.80307 WP_000537406.1.80333 WP_000537406.1.80441 WP_000537406.1.80443 WP_000537406.1.80448 WP_000537406.1.80496 WP_000537406.1.80542 WP_000537406.1.80638 WP_000537406.1.80651 WP_000537406.1.80725 WP_000537406.1.80803 WP_000537406.1.80819 WP_000537406.1.80827 WP_000537406.1.80840 WP_000537406.1.80868 WP_000537406.1.80927 WP_000537406.1.80959 WP_000537406.1.81062 WP_000537406.1.81067 WP_000537406.1.81118 WP_000537406.1.81231 WP_000537406.1.81409 WP_000537406.1.81410 WP_000537406.1.81504 WP_000537406.1.81548 WP_000537406.1.81667 WP_000537406.1.8168 WP_000537406.1.81727 WP_000537406.1.81746 WP_000537406.1.81795 WP_000537406.1.8196 WP_000537406.1.81995 WP_000537406.1.82037 WP_000537406.1.82099 WP_000537406.1.82141 WP_000537406.1.82258 WP_000537406.1.82269 WP_000537406.1.82347 WP_000537406.1.8236 WP_000537406.1.82369 WP_000537406.1.82530 WP_000537406.1.82562 WP_000537406.1.82584 WP_000537406.1.82636 WP_000537406.1.82867 WP_000537406.1.82886 WP_000537406.1.82895 WP_000537406.1.82908 WP_000537406.1.82937 WP_000537406.1.82946 WP_000537406.1.82992 WP_000537406.1.83061 WP_000537406.1.83128 WP_000537406.1.8322 WP_000537406.1.83221 WP_000537406.1.83252 WP_000537406.1.83360 WP_000537406.1.83365 WP_000537406.1.83378 WP_000537406.1.83382 WP_000537406.1.83407 WP_000537406.1.83510 WP_000537406.1.83572 WP_000537406.1.83710 WP_000537406.1.83739 WP_000537406.1.83759 WP_000537406.1.83897 WP_000537406.1.83960 WP_000537406.1.84001 WP_000537406.1.84077 WP_000537406.1.84100 WP_000537406.1.84106 WP_000537406.1.84115 WP_000537406.1.84168 WP_000537406.1.84325 WP_000537406.1.84359 WP_000537406.1.84403 WP_000537406.1.84461 WP_000537406.1.84475 WP_000537406.1.84523 WP_000537406.1.84551 WP_000537406.1.84683 WP_000537406.1.84693 WP_000537406.1.84721 WP_000537406.1.84745 WP_000537406.1.849 WP_000537406.1.85094 WP_000537406.1.85120 WP_000537406.1.85192 WP_000537406.1.85433 WP_000537406.1.8552 WP_000537406.1.85675 WP_000537406.1.85784 WP_000537406.1.85797 WP_000537406.1.85854 WP_000537406.1.85855 WP_000537406.1.8591 WP_000537406.1.85943 WP_000537406.1.86007 WP_000537406.1.86120 WP_000537406.1.86259 WP_000537406.1.86285 WP_000537406.1.86658 WP_000537406.1.86699 WP_000537406.1.86735 WP_000537406.1.86744 WP_000537406.1.86859 WP_000537406.1.86902 WP_000537406.1.86982 WP_000537406.1.87051 WP_000537406.1.87143 WP_000537406.1.87148 WP_000537406.1.87219 WP_000537406.1.87283 WP_000537406.1.87493 WP_000537406.1.87584 WP_000537406.1.8767 WP_000537406.1.87813 WP_000537406.1.87933 WP_000537406.1.87999 WP_000537406.1.8800 WP_000537406.1.88165 WP_000537406.1.88174 WP_000537406.1.88222 WP_000537406.1.88264 WP_000537406.1.88423 WP_000537406.1.88483 WP_000537406.1.88609 WP_000537406.1.88620 WP_000537406.1.88624 WP_000537406.1.88675 WP_000537406.1.88845 WP_000537406.1.88967 WP_000537406.1.88995 WP_000537406.1.89054 WP_000537406.1.89174 WP_000537406.1.89188 WP_000537406.1.89215 WP_000537406.1.89291 WP_000537406.1.89311 WP_000537406.1.89355 WP_000537406.1.89462 WP_000537406.1.8958 WP_000537406.1.89580 WP_000537406.1.89647 WP_000537406.1.89746 WP_000537406.1.89777 WP_000537406.1.89815 WP_000537406.1.89914 WP_000537406.1.89940 WP_000537406.1.90033 WP_000537406.1.90108 WP_000537406.1.90211 WP_000537406.1.90220 WP_000537406.1.90248 WP_000537406.1.90311 WP_000537406.1.90409 WP_000537406.1.90440 WP_000537406.1.90472 WP_000537406.1.90521 WP_000537406.1.90566 WP_000537406.1.90620 WP_000537406.1.90625 WP_000537406.1.9064 WP_000537406.1.90792 WP_000537406.1.90866 WP_000537406.1.90876 WP_000537406.1.90878 WP_000537406.1.9089 WP_000537406.1.90984 WP_000537406.1.90991 WP_000537406.1.91042 WP_000537406.1.91107 WP_000537406.1.9131 WP_000537406.1.91334 WP_000537406.1.91381 WP_000537406.1.91405 WP_000537406.1.91459 WP_000537406.1.91493 WP_000537406.1.91528 WP_000537406.1.91625 WP_000537406.1.91702 WP_000537406.1.91736 WP_000537406.1.92039 WP_000537406.1.92044 WP_000537406.1.92047 WP_000537406.1.92060 WP_000537406.1.92171 WP_000537406.1.92213 WP_000537406.1.92270 WP_000537406.1.92318 WP_000537406.1.92399 WP_000537406.1.92411 WP_000537406.1.92439 WP_000537406.1.92529 WP_000537406.1.92562 WP_000537406.1.92575 WP_000537406.1.92659 WP_000537406.1.92758 WP_000537406.1.92836 WP_000537406.1.92843 WP_000537406.1.92875 WP_000537406.1.92879 WP_000537406.1.92895 WP_000537406.1.92926 WP_000537406.1.92947 WP_000537406.1.93061 WP_000537406.1.93213 WP_000537406.1.93275 WP_000537406.1.93322 WP_000537406.1.93376 WP_000537406.1.93596 WP_000537406.1.93604 WP_000537406.1.93671 WP_000537406.1.93741 WP_000537406.1.93761 WP_000537406.1.93767 WP_000537406.1.93803 WP_000537406.1.93837 WP_000537406.1.94167 WP_000537406.1.94379 WP_000537406.1.94383 WP_000537406.1.94412 WP_000537406.1.94557 WP_000537406.1.94722 WP_000537406.1.94798 WP_000537406.1.94849 WP_000537406.1.94862 WP_000537406.1.94967 WP_000537406.1.94986 WP_000537406.1.94987 WP_000537406.1.9503 WP_000537406.1.95094 WP_000537406.1.95152 WP_000537406.1.9516 WP_000537406.1.95235 WP_000537406.1.95249 WP_000537406.1.95289 WP_000537406.1.95404 WP_000537406.1.95465 WP_000537406.1.95579 WP_000537406.1.95701 WP_000537406.1.9574 WP_000537406.1.95744 WP_000537406.1.95803 WP_000537406.1.95805 WP_000537406.1.95826 WP_000537406.1.95901 WP_000537406.1.96045 WP_000537406.1.96190 WP_000537406.1.96203 WP_000537406.1.96206 WP_000537406.1.96404 WP_000537406.1.96429 WP_000537406.1.96497 WP_000537406.1.96533 WP_000537406.1.96640 WP_000537406.1.96662 WP_000537406.1.96721 WP_000537406.1.96758 WP_000537406.1.96761 WP_000537406.1.96798 WP_000537406.1.9686 WP_000537406.1.96890 WP_000537406.1.96902 WP_000537406.1.97005 WP_000537406.1.97043 WP_000537406.1.97089 WP_000537406.1.97109 WP_000537406.1.97185 WP_000537406.1.97368 WP_000537406.1.97386 WP_000537406.1.97413 WP_000537406.1.97496 WP_000537406.1.97534 WP_000537406.1.97628 WP_000537406.1.97693 WP_000537406.1.97768 WP_000537406.1.97873 WP_000537406.1.97983 WP_000537406.1.9805 WP_000537406.1.98107 WP_000537406.1.9811 WP_000537406.1.98201 WP_000537406.1.98236 WP_000537406.1.98392 WP_000537406.1.98402 WP_000537406.1.98403 WP_000537406.1.98446 WP_000537406.1.98483 WP_000537406.1.98513 WP_000537406.1.98551 WP_000537406.1.98608 WP_000537406.1.98627 WP_000537406.1.98751 WP_000537406.1.98763 WP_000537406.1.9887 WP_000537406.1.98931 WP_000537406.1.98947 WP_000537406.1.99040 WP_000537406.1.99071 WP_000537406.1.99083 WP_000537406.1.99107 WP_000537406.1.99197 WP_000537406.1.99219 WP_000537406.1.99255 WP_000537406.1.99327 WP_000537406.1.99339 WP_000537406.1.99370 WP_000537406.1.99469 WP_000537406.1.99725 WP_000537406.1.99747 WP_000537406.1.99824 ABAK02000001|CDS_394376-393408 ABAM02000001|CDS_1491417-1490449 ABAN01000005|CDS_29953-30921 ABEH02000007|CDS_222245-221277 ABEI01000004|CDS_262040-261072 ABEJ01000007|CDS_159504-158536 ABFF01000028|CDS_30133-31101 ABFG01000010|CDS_44367-45335 CP000886|CDS_2125919-2126887 CP001113|CDS_996639-995671 CP001127|CDS_1044684-1043716 NZ_ACBF01000025|CDS_50189-49221 gi|452120878|ref|YP_007471126.1| gi|194443128|ref|YP_002040156.1| gi|161614812|ref|YP_001588777.1| gi|409249365|ref|YP_006885196.1| 272994.SPAB_02564 423368.SNSL254_A0991 439843.SeSA_A1072 gi|538361449|ref|YP_008504734.1| gi|194735517|ref|YP_002114010.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]