SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|194444419|ref|YP_002042845.1| from Salmonella enterica subsp. enterica serovar Newport str. SL254

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|194444419|ref|YP_002042845.1|
Domain Number 1 Region: 1-365
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 1.4e-56
Family FAD/NAD-linked reductases, N-terminal and central domains 0.00000033
Further Details:      
 
Domain Number 2 Region: 336-450
Classification Level Classification E-value
Superfamily FAD/NAD-linked reductases, dimerisation (C-terminal) domain 1.01e-36
Family FAD/NAD-linked reductases, dimerisation (C-terminal) domain 0.000000509
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|194444419|ref|YP_002042845.1|
Sequence length 450
Comment glutathione reductase [Salmonella enterica subsp. enterica serovar Newport str. SL254]
Sequence
MTKHYDYIAIGGGSGGIASINRAAMYGQKCALIEAKELGGTCVNVGCVPKKVMWHAAQIR
EAIHLYGPDYGFDTTINQFDWSKLIASRTAYIDRIHTSYDNVLGKNNVDVIKGFARFVDA
KTIEVNGETITADHILIATGGRPSHPEIPGVEYGIDSDGFFALSALPERVAVVGAGYIAV
ELAGVINALGAKTHLFVRKHAPLRSFDPMISETLVEVMNAEGPQLHTHAVPKAVVKNADG
SLTLELEDGRSETVDCLIWAIGREPSTDNINLAAAGVKTNEKGYIIVDKFQNTNVEGIYA
VGDNTGAVELTPVAVAAGRRLSERLFNNKPDEHLDYSNIPTVVFSHPPIGTVGLSEPQAR
EQYGDEQVKVYKSSFTAMYTAVTTHRQPCRMKLVCVGPEEKIVGIHGIGFGMDEMLQGFA
VALKMGATKKDFDNTVAIHPTASEEFVTMR
Download sequence
Identical sequences A0A0H3BR52 A0A0L3JQX9 A0A0R9NVY2 A0A1J4QM10 A0A1S1AQ07 A0A221Z7K0 A0A242UMT2 C0Q152 G5PU52 G5S2C1
CP000857|CDS_3701205-3702557 CP001113|CDS_3743146-3744498 WP_000160773.1.100129 WP_000160773.1.100502 WP_000160773.1.100521 WP_000160773.1.100711 WP_000160773.1.101744 WP_000160773.1.10675 WP_000160773.1.11362 WP_000160773.1.11938 WP_000160773.1.12877 WP_000160773.1.1326 WP_000160773.1.14505 WP_000160773.1.15483 WP_000160773.1.15625 WP_000160773.1.15637 WP_000160773.1.15708 WP_000160773.1.15795 WP_000160773.1.16125 WP_000160773.1.16331 WP_000160773.1.16941 WP_000160773.1.16942 WP_000160773.1.17285 WP_000160773.1.1737 WP_000160773.1.17447 WP_000160773.1.17991 WP_000160773.1.18281 WP_000160773.1.18441 WP_000160773.1.18489 WP_000160773.1.18692 WP_000160773.1.1897 WP_000160773.1.19163 WP_000160773.1.19967 WP_000160773.1.20364 WP_000160773.1.20391 WP_000160773.1.20425 WP_000160773.1.20695 WP_000160773.1.21260 WP_000160773.1.21792 WP_000160773.1.22337 WP_000160773.1.22514 WP_000160773.1.22575 WP_000160773.1.23155 WP_000160773.1.23621 WP_000160773.1.23736 WP_000160773.1.2415 WP_000160773.1.24303 WP_000160773.1.25700 WP_000160773.1.25708 WP_000160773.1.26269 WP_000160773.1.26363 WP_000160773.1.26426 WP_000160773.1.26582 WP_000160773.1.27419 WP_000160773.1.28504 WP_000160773.1.28612 WP_000160773.1.28902 WP_000160773.1.28921 WP_000160773.1.29174 WP_000160773.1.30018 WP_000160773.1.30909 WP_000160773.1.31210 WP_000160773.1.31262 WP_000160773.1.31476 WP_000160773.1.31720 WP_000160773.1.32357 WP_000160773.1.32643 WP_000160773.1.3445 WP_000160773.1.35460 WP_000160773.1.36157 WP_000160773.1.36792 WP_000160773.1.37363 WP_000160773.1.37558 WP_000160773.1.38199 WP_000160773.1.38408 WP_000160773.1.38857 WP_000160773.1.39059 WP_000160773.1.40771 WP_000160773.1.42262 WP_000160773.1.42797 WP_000160773.1.42829 WP_000160773.1.42861 WP_000160773.1.42887 WP_000160773.1.43070 WP_000160773.1.43160 WP_000160773.1.43476 WP_000160773.1.43763 WP_000160773.1.43875 WP_000160773.1.4405 WP_000160773.1.44132 WP_000160773.1.4422 WP_000160773.1.44440 WP_000160773.1.44781 WP_000160773.1.45402 WP_000160773.1.45566 WP_000160773.1.46091 WP_000160773.1.46730 WP_000160773.1.46961 WP_000160773.1.47014 WP_000160773.1.47714 WP_000160773.1.48647 WP_000160773.1.49102 WP_000160773.1.49226 WP_000160773.1.49931 WP_000160773.1.50007 WP_000160773.1.5009 WP_000160773.1.50811 WP_000160773.1.51139 WP_000160773.1.51162 WP_000160773.1.51414 WP_000160773.1.51555 WP_000160773.1.51611 WP_000160773.1.51900 WP_000160773.1.52608 WP_000160773.1.5273 WP_000160773.1.53016 WP_000160773.1.53694 WP_000160773.1.54061 WP_000160773.1.54082 WP_000160773.1.54159 WP_000160773.1.5517 WP_000160773.1.56069 WP_000160773.1.56247 WP_000160773.1.56261 WP_000160773.1.56393 WP_000160773.1.57084 WP_000160773.1.57149 WP_000160773.1.57357 WP_000160773.1.57534 WP_000160773.1.58249 WP_000160773.1.58301 WP_000160773.1.58334 WP_000160773.1.58564 WP_000160773.1.59012 WP_000160773.1.59648 WP_000160773.1.59928 WP_000160773.1.5993 WP_000160773.1.60661 WP_000160773.1.60746 WP_000160773.1.60838 WP_000160773.1.61233 WP_000160773.1.61737 WP_000160773.1.6210 WP_000160773.1.62361 WP_000160773.1.62404 WP_000160773.1.63043 WP_000160773.1.63150 WP_000160773.1.63234 WP_000160773.1.63250 WP_000160773.1.63525 WP_000160773.1.63824 WP_000160773.1.63992 WP_000160773.1.64242 WP_000160773.1.64569 WP_000160773.1.65838 WP_000160773.1.66074 WP_000160773.1.66167 WP_000160773.1.66534 WP_000160773.1.66630 WP_000160773.1.67184 WP_000160773.1.67374 WP_000160773.1.6833 WP_000160773.1.6869 WP_000160773.1.6879 WP_000160773.1.68818 WP_000160773.1.69288 WP_000160773.1.7014 WP_000160773.1.70326 WP_000160773.1.70523 WP_000160773.1.70547 WP_000160773.1.71088 WP_000160773.1.71500 WP_000160773.1.72065 WP_000160773.1.72438 WP_000160773.1.72850 WP_000160773.1.73144 WP_000160773.1.73270 WP_000160773.1.73701 WP_000160773.1.7458 WP_000160773.1.74757 WP_000160773.1.74996 WP_000160773.1.75134 WP_000160773.1.75793 WP_000160773.1.76197 WP_000160773.1.76208 WP_000160773.1.77543 WP_000160773.1.77987 WP_000160773.1.78180 WP_000160773.1.78602 WP_000160773.1.80707 WP_000160773.1.80803 WP_000160773.1.81667 WP_000160773.1.8196 WP_000160773.1.82562 WP_000160773.1.82886 WP_000160773.1.82895 WP_000160773.1.82937 WP_000160773.1.82992 WP_000160773.1.83061 WP_000160773.1.84325 WP_000160773.1.84359 WP_000160773.1.84523 WP_000160773.1.85120 WP_000160773.1.8552 WP_000160773.1.86859 WP_000160773.1.86982 WP_000160773.1.87143 WP_000160773.1.87283 WP_000160773.1.87346 WP_000160773.1.87370 WP_000160773.1.89355 WP_000160773.1.90220 WP_000160773.1.91453 WP_000160773.1.91528 WP_000160773.1.91579 WP_000160773.1.92047 WP_000160773.1.92439 WP_000160773.1.93596 WP_000160773.1.94167 WP_000160773.1.94722 WP_000160773.1.94798 WP_000160773.1.9516 WP_000160773.1.96141 WP_000160773.1.96203 WP_000160773.1.96798 WP_000160773.1.97185 WP_000160773.1.97260 WP_000160773.1.97873 WP_000160773.1.98403 WP_000160773.1.98513 WP_000160773.1.98608 gi|528817007|ref|YP_008358210.1| gi|194444419|ref|YP_002042845.1| gi|224585390|ref|YP_002639189.1| 423368.SNSL254_A3869 476213.SPC_3667

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]