SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|194444842|ref|YP_002042486.1| from Salmonella enterica subsp. enterica serovar Newport str. SL254

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|194444842|ref|YP_002042486.1|
Domain Number 1 Region: 1-362
Classification Level Classification E-value
Superfamily FMN-linked oxidoreductases 1.18e-109
Family FMN-linked oxidoreductases 0.0000000000488
Further Details:      
 
Domain Number 2 Region: 333-520
Classification Level Classification E-value
Superfamily Nucleotide-binding domain 2.94e-41
Family N-terminal domain of adrenodoxin reductase-like 0.000000929
Further Details:      
 
Domain Number 3 Region: 461-518,556-650
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 5.02e-28
Family C-terminal domain of adrenodoxin reductase-like 0.00000126
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|194444842|ref|YP_002042486.1|
Sequence length 672
Comment FAD/FMN-binding/pyridine nucleotide-disulfide oxidoreductase family protein [Salmonella enterica subsp. enterica serovar Newport str. SL254]
Sequence
MSYPSLFAPLDLGFTTLRNRVLMGSMHTGLEEHPDGAERLAAFYAERARHGVALIVTGGI
APVPSGVVMTGGAMLNDASQLTPHRVVTDAVHAQGGKIALQILHTGRYSYQPHLVAPSAI
QAPINRFMPHELTHDEILQLIDDFAHCAQLAREAGYDGVEVMGSEGYLINEFLTRRTNHR
DDEWGGDYASRMRFAVEVVRAVRQRVGNDFIIIYRLSMLDLVVNGGTFDETVQLAQAIEA
AGASLINTGIGWHEARIPTIATPVPRGAFSWVTRKLKGHVSVPLIATNRINDPQVAETIL
TRGDADMVSMARPFLADAEFLTKAQSGRADEINTCIGCNQACLDRIFIGKVTSCLVNPRA
CHETHMPITPAIRKKNLAVVGAGPAGLAFAINAASRGHHVTLFDAQSEIGGQFTIARQIP
GKEEFYETLRYYRRMIDVTGVTLKLNQRVNAEDLQPFDEAILACGIVPRRPPIDGIDHPK
VLTYLEVLRDKAPVGKRVAIIGCGGIGFDTAMYLSQHGESTSQNIAEFCTEWGIDTSLQQ
AGGLRPEGPRLARSPRQIVMLQRKASKPGEGLGKTTGWIHRATLLARGVKMIPAVSYQKI
DDDGLHLLIGGEPQLLEVDHVVICAGQEPRRELADPLRAAGKTVHLIGGCDVAMELDARR
AIAQGTRLALEI
Download sequence
Identical sequences A0A0H3BS44 A0A0R9MXC5 A0A242UTF1
gi|528821061|ref|YP_008362264.1| CP001113|CDS_3375584-3377602 423368.SNSL254_A3480 WP_000121526.1.100502 WP_000121526.1.100521 WP_000121526.1.100711 WP_000121526.1.10675 WP_000121526.1.11362 WP_000121526.1.1326 WP_000121526.1.14505 WP_000121526.1.15483 WP_000121526.1.15625 WP_000121526.1.15708 WP_000121526.1.15922 WP_000121526.1.16331 WP_000121526.1.16941 WP_000121526.1.17285 WP_000121526.1.1737 WP_000121526.1.17447 WP_000121526.1.17991 WP_000121526.1.18281 WP_000121526.1.18692 WP_000121526.1.1897 WP_000121526.1.20391 WP_000121526.1.20425 WP_000121526.1.20695 WP_000121526.1.21792 WP_000121526.1.22514 WP_000121526.1.22575 WP_000121526.1.22582 WP_000121526.1.23155 WP_000121526.1.23621 WP_000121526.1.23736 WP_000121526.1.26363 WP_000121526.1.26426 WP_000121526.1.26582 WP_000121526.1.27419 WP_000121526.1.28612 WP_000121526.1.30909 WP_000121526.1.31210 WP_000121526.1.31476 WP_000121526.1.35460 WP_000121526.1.36157 WP_000121526.1.37558 WP_000121526.1.38199 WP_000121526.1.38408 WP_000121526.1.42797 WP_000121526.1.42829 WP_000121526.1.42887 WP_000121526.1.43875 WP_000121526.1.4405 WP_000121526.1.44440 WP_000121526.1.44781 WP_000121526.1.46091 WP_000121526.1.46250 WP_000121526.1.46730 WP_000121526.1.46961 WP_000121526.1.47714 WP_000121526.1.48493 WP_000121526.1.49102 WP_000121526.1.49226 WP_000121526.1.49931 WP_000121526.1.5009 WP_000121526.1.51162 WP_000121526.1.51414 WP_000121526.1.51555 WP_000121526.1.51611 WP_000121526.1.53694 WP_000121526.1.54061 WP_000121526.1.54082 WP_000121526.1.5517 WP_000121526.1.56247 WP_000121526.1.56393 WP_000121526.1.57149 WP_000121526.1.57357 WP_000121526.1.57735 WP_000121526.1.58249 WP_000121526.1.58564 WP_000121526.1.59125 WP_000121526.1.59928 WP_000121526.1.60746 WP_000121526.1.60838 WP_000121526.1.61233 WP_000121526.1.6210 WP_000121526.1.63043 WP_000121526.1.63234 WP_000121526.1.63250 WP_000121526.1.63824 WP_000121526.1.63992 WP_000121526.1.64242 WP_000121526.1.64569 WP_000121526.1.65838 WP_000121526.1.66167 WP_000121526.1.66534 WP_000121526.1.66630 WP_000121526.1.67184 WP_000121526.1.67374 WP_000121526.1.6833 WP_000121526.1.6869 WP_000121526.1.68818 WP_000121526.1.69288 WP_000121526.1.7014 WP_000121526.1.70326 WP_000121526.1.70523 WP_000121526.1.70547 WP_000121526.1.72065 WP_000121526.1.72850 WP_000121526.1.73144 WP_000121526.1.74996 WP_000121526.1.75793 WP_000121526.1.76208 WP_000121526.1.77543 WP_000121526.1.78602 WP_000121526.1.81667 WP_000121526.1.82895 WP_000121526.1.82937 WP_000121526.1.82992 WP_000121526.1.83061 WP_000121526.1.85120 WP_000121526.1.8552 WP_000121526.1.86982 WP_000121526.1.87143 WP_000121526.1.87283 WP_000121526.1.89354 WP_000121526.1.90472 WP_000121526.1.92047 WP_000121526.1.92439 WP_000121526.1.93596 WP_000121526.1.9516 WP_000121526.1.96798 WP_000121526.1.98627 WP_000121526.1.99071 gi|194444842|ref|YP_002042486.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]