SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|448967507|ref|YP_007419096.1| from Salmonella enterica subsp. enterica serovar Newport str. SL254

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|448967507|ref|YP_007419096.1|
Domain Number 1 Region: 206-514
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 9.88e-49
Family FAD/NAD-linked reductases, N-terminal and central domains 0.00000294
Further Details:      
 
Domain Number 2 Region: 1-101
Classification Level Classification E-value
Superfamily Thioredoxin-like 6.04e-29
Family PDI-like 0.0000023
Further Details:      
 
Domain Number 3 Region: 106-197
Classification Level Classification E-value
Superfamily Thioredoxin-like 9.61e-25
Family PDI-like 0.00000531
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|448967507|ref|YP_007419096.1|
Sequence length 521
Comment alkyl hydroperoxide reductase subunit F [Salmonella enterica subsp. enterica serovar Newport str. SL254]
Sequence
MLDTNMKTQLRAYLEKLTKPVELIATLDDSAKSAEIKELLAEIAELSDKVTFKEDNTLPV
RKPSFLITNPGSQQGPRFAGSPLGHEFTSLVLALLWTGGHPSKEAQSLLEQIRDIDGDFE
FETYYSLSCHNCPDVVQALNLMAVLNPRIKHTAIDGGTFQNEITERNVMGVPAVFVNGKE
FGQGRMTLTEIVAKVDTGAEKRAAEALNKRDAYDVLIVGSGPAGAAAAVYSARKGIRTGL
MGERFGGQVLDTVDIENYISVPKTEGQKLAGALKAHVSDYDVDVIDSQSASKLVPAATEG
GLHQIETASGAVLKARSIIIATGAKWRNMNVPGEDQYRTKGVTYCPHCDGPLFKGKRVAV
IGGGNSGVEAAIDLAGIVEHVTLLEFAPEMKADQVLQDKVRSLKNVDIILNAQTTEVKGD
GSKVVGLEYRDRVSGDIHSVALAGIFVQIGLLPNTHWLEGALERNRMGEIIIDAKCETSV
KGIFAAGDCTTVPYKQIIIATGEGAKASLSAFDYLIRTKIA
Download sequence
Identical sequences A0A0R9MB27 A0A242UU96 A0A2D3TYC5
gi|525948035|ref|YP_008309543.1| WP_000887643.1.100002 WP_000887643.1.100115 WP_000887643.1.100472 WP_000887643.1.100502 WP_000887643.1.100650 WP_000887643.1.100711 WP_000887643.1.100948 WP_000887643.1.101185 WP_000887643.1.101520 WP_000887643.1.10675 WP_000887643.1.11865 WP_000887643.1.12244 WP_000887643.1.12584 WP_000887643.1.12718 WP_000887643.1.1326 WP_000887643.1.13311 WP_000887643.1.14286 WP_000887643.1.14516 WP_000887643.1.14737 WP_000887643.1.15079 WP_000887643.1.15625 WP_000887643.1.15708 WP_000887643.1.15909 WP_000887643.1.16006 WP_000887643.1.16331 WP_000887643.1.16819 WP_000887643.1.1689 WP_000887643.1.16941 WP_000887643.1.16944 WP_000887643.1.17285 WP_000887643.1.17447 WP_000887643.1.17755 WP_000887643.1.17991 WP_000887643.1.18249 WP_000887643.1.18281 WP_000887643.1.18692 WP_000887643.1.1897 WP_000887643.1.19660 WP_000887643.1.20376 WP_000887643.1.20391 WP_000887643.1.20425 WP_000887643.1.20695 WP_000887643.1.20721 WP_000887643.1.21792 WP_000887643.1.22514 WP_000887643.1.23155 WP_000887643.1.23169 WP_000887643.1.23172 WP_000887643.1.23643 WP_000887643.1.23685 WP_000887643.1.23736 WP_000887643.1.24259 WP_000887643.1.2554 WP_000887643.1.26030 WP_000887643.1.26269 WP_000887643.1.2634 WP_000887643.1.26363 WP_000887643.1.26426 WP_000887643.1.26582 WP_000887643.1.2660 WP_000887643.1.27419 WP_000887643.1.27556 WP_000887643.1.27755 WP_000887643.1.27997 WP_000887643.1.29924 WP_000887643.1.30909 WP_000887643.1.31210 WP_000887643.1.31476 WP_000887643.1.31762 WP_000887643.1.32434 WP_000887643.1.33078 WP_000887643.1.33817 WP_000887643.1.34496 WP_000887643.1.34667 WP_000887643.1.3489 WP_000887643.1.36157 WP_000887643.1.36899 WP_000887643.1.37558 WP_000887643.1.38001 WP_000887643.1.38199 WP_000887643.1.38273 WP_000887643.1.39038 WP_000887643.1.39385 WP_000887643.1.39553 WP_000887643.1.40111 WP_000887643.1.40528 WP_000887643.1.4178 WP_000887643.1.42685 WP_000887643.1.42797 WP_000887643.1.42829 WP_000887643.1.42887 WP_000887643.1.42957 WP_000887643.1.43086 WP_000887643.1.43875 WP_000887643.1.4405 WP_000887643.1.44438 WP_000887643.1.44440 WP_000887643.1.44781 WP_000887643.1.46250 WP_000887643.1.46286 WP_000887643.1.46322 WP_000887643.1.46574 WP_000887643.1.46666 WP_000887643.1.46730 WP_000887643.1.46961 WP_000887643.1.47257 WP_000887643.1.47714 WP_000887643.1.47814 WP_000887643.1.47928 WP_000887643.1.48209 WP_000887643.1.48455 WP_000887643.1.48570 WP_000887643.1.48985 WP_000887643.1.49102 WP_000887643.1.49175 WP_000887643.1.49226 WP_000887643.1.49472 WP_000887643.1.49931 WP_000887643.1.50007 WP_000887643.1.5009 WP_000887643.1.50239 WP_000887643.1.50576 WP_000887643.1.51162 WP_000887643.1.51464 WP_000887643.1.51555 WP_000887643.1.51594 WP_000887643.1.51611 WP_000887643.1.51841 WP_000887643.1.5216 WP_000887643.1.52438 WP_000887643.1.53454 WP_000887643.1.53688 WP_000887643.1.53694 WP_000887643.1.53935 WP_000887643.1.54061 WP_000887643.1.54082 WP_000887643.1.54569 WP_000887643.1.5517 WP_000887643.1.55223 WP_000887643.1.55706 WP_000887643.1.56247 WP_000887643.1.56305 WP_000887643.1.56393 WP_000887643.1.56853 WP_000887643.1.56893 WP_000887643.1.57125 WP_000887643.1.57149 WP_000887643.1.57307 WP_000887643.1.57357 WP_000887643.1.57735 WP_000887643.1.58040 WP_000887643.1.58249 WP_000887643.1.58301 WP_000887643.1.59125 WP_000887643.1.59336 WP_000887643.1.59381 WP_000887643.1.59641 WP_000887643.1.59830 WP_000887643.1.59928 WP_000887643.1.60052 WP_000887643.1.60643 WP_000887643.1.60746 WP_000887643.1.60838 WP_000887643.1.60919 WP_000887643.1.61201 WP_000887643.1.61233 WP_000887643.1.6164 WP_000887643.1.6210 WP_000887643.1.63043 WP_000887643.1.63234 WP_000887643.1.63422 WP_000887643.1.63677 WP_000887643.1.63824 WP_000887643.1.63934 WP_000887643.1.63992 WP_000887643.1.64007 WP_000887643.1.64242 WP_000887643.1.64569 WP_000887643.1.64667 WP_000887643.1.64920 WP_000887643.1.65027 WP_000887643.1.65163 WP_000887643.1.65838 WP_000887643.1.66167 WP_000887643.1.66270 WP_000887643.1.66534 WP_000887643.1.67184 WP_000887643.1.67288 WP_000887643.1.67374 WP_000887643.1.68532 WP_000887643.1.6869 WP_000887643.1.6875 WP_000887643.1.68818 WP_000887643.1.69288 WP_000887643.1.69371 WP_000887643.1.69465 WP_000887643.1.69636 WP_000887643.1.69754 WP_000887643.1.7014 WP_000887643.1.7016 WP_000887643.1.70321 WP_000887643.1.70326 WP_000887643.1.70488 WP_000887643.1.70523 WP_000887643.1.70547 WP_000887643.1.70580 WP_000887643.1.71446 WP_000887643.1.7174 WP_000887643.1.71756 WP_000887643.1.72065 WP_000887643.1.72226 WP_000887643.1.73144 WP_000887643.1.73535 WP_000887643.1.73831 WP_000887643.1.74620 WP_000887643.1.74644 WP_000887643.1.74702 WP_000887643.1.74996 WP_000887643.1.75177 WP_000887643.1.75402 WP_000887643.1.75793 WP_000887643.1.76097 WP_000887643.1.76208 WP_000887643.1.76364 WP_000887643.1.76471 WP_000887643.1.76806 WP_000887643.1.77414 WP_000887643.1.77543 WP_000887643.1.77729 WP_000887643.1.77846 WP_000887643.1.78201 WP_000887643.1.78602 WP_000887643.1.78928 WP_000887643.1.79235 WP_000887643.1.7979 WP_000887643.1.80529 WP_000887643.1.81472 WP_000887643.1.81667 WP_000887643.1.82529 WP_000887643.1.82584 WP_000887643.1.82841 WP_000887643.1.82867 WP_000887643.1.82895 WP_000887643.1.82992 WP_000887643.1.83061 WP_000887643.1.83650 WP_000887643.1.83759 WP_000887643.1.83854 WP_000887643.1.84355 WP_000887643.1.85120 WP_000887643.1.85469 WP_000887643.1.86310 WP_000887643.1.86453 WP_000887643.1.86982 WP_000887643.1.87875 WP_000887643.1.9002 WP_000887643.1.90248 WP_000887643.1.90348 WP_000887643.1.90363 WP_000887643.1.90409 WP_000887643.1.91470 WP_000887643.1.92047 WP_000887643.1.92299 WP_000887643.1.92439 WP_000887643.1.92529 WP_000887643.1.92729 WP_000887643.1.92975 WP_000887643.1.93596 WP_000887643.1.93761 WP_000887643.1.94064 WP_000887643.1.94947 WP_000887643.1.9516 WP_000887643.1.95171 WP_000887643.1.96335 WP_000887643.1.96798 WP_000887643.1.96810 WP_000887643.1.97725 WP_000887643.1.98314 WP_000887643.1.98513 WP_000887643.1.98899 WP_000887643.1.99725 gi|448967507|ref|YP_007419096.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]