SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|194396923|ref|YP_002037147.1| from Streptococcus pneumoniae G54

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|194396923|ref|YP_002037147.1|
Domain Number 1 Region: 4-102
Classification Level Classification E-value
Superfamily Enzyme IIa from lactose specific PTS, IIa-lac 1.1e-31
Family Enzyme IIa from lactose specific PTS, IIa-lac 0.0000965
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|194396923|ref|YP_002037147.1|
Sequence length 114
Comment PTS system transporter subunit IIA [Streptococcus pneumoniae G54]
Sequence
MKSKEEINMLGFTIVAYAGDARSDLMDALAFARDGYFEQARELVESANDSIVSAHREQTN
LLAEEASGDNFEVSFIMIHGQDTLMTTMLLYDQVKFFIDEYERIRKIEEHIGLQ
Download sequence
Identical sequences A0A0B7MF99 A5LK35 B1I9R6 F9HL29 M5K6P7 M5KLY1 M5MX86
gi|307067110|ref|YP_003876076.1| gi|194396923|ref|YP_002037147.1| gi|307126695|ref|YP_003878726.1| gi|169832896|ref|YP_001693979.1| 487214.SPH_0588 488223.SPP_0501 512566.SPG_0432 gi|225856198|ref|YP_002737709.1| WP_000836780.1.100026 WP_000836780.1.10009 WP_000836780.1.100109 WP_000836780.1.100140 WP_000836780.1.100158 WP_000836780.1.100168 WP_000836780.1.100169 WP_000836780.1.10020 WP_000836780.1.100263 WP_000836780.1.100289 WP_000836780.1.100339 WP_000836780.1.100364 WP_000836780.1.100369 WP_000836780.1.10049 WP_000836780.1.100532 WP_000836780.1.100547 WP_000836780.1.10060 WP_000836780.1.100679 WP_000836780.1.100681 WP_000836780.1.100734 WP_000836780.1.100756 WP_000836780.1.100818 WP_000836780.1.100839 WP_000836780.1.100848 WP_000836780.1.100863 WP_000836780.1.100911 WP_000836780.1.100937 WP_000836780.1.101061 WP_000836780.1.101106 WP_000836780.1.101135 WP_000836780.1.101176 WP_000836780.1.101178 WP_000836780.1.101205 WP_000836780.1.10122 WP_000836780.1.101232 WP_000836780.1.101250 WP_000836780.1.101394 WP_000836780.1.101410 WP_000836780.1.101484 WP_000836780.1.101497 WP_000836780.1.101595 WP_000836780.1.101614 WP_000836780.1.101649 WP_000836780.1.10169 WP_000836780.1.101738 WP_000836780.1.101806 WP_000836780.1.101847 WP_000836780.1.101895 WP_000836780.1.10196 WP_000836780.1.101988 WP_000836780.1.102077 WP_000836780.1.1026 WP_000836780.1.10364 WP_000836780.1.10494 WP_000836780.1.10499 WP_000836780.1.10571 WP_000836780.1.10574 WP_000836780.1.1059 WP_000836780.1.10591 WP_000836780.1.10613 WP_000836780.1.10820 WP_000836780.1.10900 WP_000836780.1.10910 WP_000836780.1.10933 WP_000836780.1.10934 WP_000836780.1.10948 WP_000836780.1.11027 WP_000836780.1.11043 WP_000836780.1.11103 WP_000836780.1.11144 WP_000836780.1.11197 WP_000836780.1.11358 WP_000836780.1.11383 WP_000836780.1.11425 WP_000836780.1.11428 WP_000836780.1.11448 WP_000836780.1.11509 WP_000836780.1.11510 WP_000836780.1.11537 WP_000836780.1.11594 WP_000836780.1.11617 WP_000836780.1.1178 WP_000836780.1.11792 WP_000836780.1.11858 WP_000836780.1.11902 WP_000836780.1.1192 WP_000836780.1.11931 WP_000836780.1.12182 WP_000836780.1.1221 WP_000836780.1.12238 WP_000836780.1.12273 WP_000836780.1.12306 WP_000836780.1.12312 WP_000836780.1.12383 WP_000836780.1.124 WP_000836780.1.12407 WP_000836780.1.12428 WP_000836780.1.12440 WP_000836780.1.12444 WP_000836780.1.12450 WP_000836780.1.12470 WP_000836780.1.12494 WP_000836780.1.12524 WP_000836780.1.12538 WP_000836780.1.12580 WP_000836780.1.1262 WP_000836780.1.12729 WP_000836780.1.12805 WP_000836780.1.12952 WP_000836780.1.12958 WP_000836780.1.12966 WP_000836780.1.12996 WP_000836780.1.13000 WP_000836780.1.1302 WP_000836780.1.13036 WP_000836780.1.13099 WP_000836780.1.13168 WP_000836780.1.13256 WP_000836780.1.13351 WP_000836780.1.13382 WP_000836780.1.13388 WP_000836780.1.13515 WP_000836780.1.13570 WP_000836780.1.13581 WP_000836780.1.1368 WP_000836780.1.13692 WP_000836780.1.13705 WP_000836780.1.13845 WP_000836780.1.13917 WP_000836780.1.13954 WP_000836780.1.13989 WP_000836780.1.14012 WP_000836780.1.14051 WP_000836780.1.14066 WP_000836780.1.14107 WP_000836780.1.14211 WP_000836780.1.14218 WP_000836780.1.14254 WP_000836780.1.14291 WP_000836780.1.14294 WP_000836780.1.14335 WP_000836780.1.14350 WP_000836780.1.14408 WP_000836780.1.14430 WP_000836780.1.14435 WP_000836780.1.1449 WP_000836780.1.145 WP_000836780.1.14513 WP_000836780.1.14662 WP_000836780.1.14682 WP_000836780.1.14722 WP_000836780.1.14757 WP_000836780.1.14780 WP_000836780.1.14831 WP_000836780.1.14880 WP_000836780.1.14885 WP_000836780.1.14949 WP_000836780.1.14975 WP_000836780.1.15030 WP_000836780.1.15058 WP_000836780.1.15061 WP_000836780.1.15081 WP_000836780.1.15135 WP_000836780.1.15155 WP_000836780.1.1522 WP_000836780.1.15220 WP_000836780.1.15266 WP_000836780.1.15366 WP_000836780.1.15370 WP_000836780.1.15390 WP_000836780.1.15391 WP_000836780.1.1541 WP_000836780.1.15498 WP_000836780.1.15504 WP_000836780.1.15509 WP_000836780.1.15513 WP_000836780.1.15523 WP_000836780.1.15575 WP_000836780.1.15635 WP_000836780.1.15650 WP_000836780.1.1566 WP_000836780.1.15661 WP_000836780.1.15709 WP_000836780.1.15788 WP_000836780.1.15800 WP_000836780.1.15841 WP_000836780.1.15844 WP_000836780.1.16049 WP_000836780.1.16093 WP_000836780.1.16184 WP_000836780.1.16229 WP_000836780.1.16316 WP_000836780.1.16317 WP_000836780.1.16330 WP_000836780.1.16337 WP_000836780.1.16359 WP_000836780.1.16375 WP_000836780.1.16470 WP_000836780.1.16479 WP_000836780.1.16509 WP_000836780.1.16555 WP_000836780.1.16568 WP_000836780.1.16570 WP_000836780.1.16630 WP_000836780.1.16778 WP_000836780.1.168 WP_000836780.1.16813 WP_000836780.1.1682 WP_000836780.1.16831 WP_000836780.1.1684 WP_000836780.1.1686 WP_000836780.1.17029 WP_000836780.1.17033 WP_000836780.1.1711 WP_000836780.1.17133 WP_000836780.1.17144 WP_000836780.1.17163 WP_000836780.1.1724 WP_000836780.1.17257 WP_000836780.1.17269 WP_000836780.1.17315 WP_000836780.1.17330 WP_000836780.1.17474 WP_000836780.1.17571 WP_000836780.1.17601 WP_000836780.1.17609 WP_000836780.1.17652 WP_000836780.1.17665 WP_000836780.1.17677 WP_000836780.1.17706 WP_000836780.1.17715 WP_000836780.1.17775 WP_000836780.1.1783 WP_000836780.1.17844 WP_000836780.1.17917 WP_000836780.1.17965 WP_000836780.1.17972 WP_000836780.1.18180 WP_000836780.1.18230 WP_000836780.1.18244 WP_000836780.1.18258 WP_000836780.1.18278 WP_000836780.1.18285 WP_000836780.1.18342 WP_000836780.1.18357 WP_000836780.1.18404 WP_000836780.1.18464 WP_000836780.1.18514 WP_000836780.1.18571 WP_000836780.1.18630 WP_000836780.1.18638 WP_000836780.1.18670 WP_000836780.1.18733 WP_000836780.1.18768 WP_000836780.1.18771 WP_000836780.1.18831 WP_000836780.1.18869 WP_000836780.1.1894 WP_000836780.1.18951 WP_000836780.1.19000 WP_000836780.1.19010 WP_000836780.1.19127 WP_000836780.1.19172 WP_000836780.1.19190 WP_000836780.1.19275 WP_000836780.1.19359 WP_000836780.1.19368 WP_000836780.1.19383 WP_000836780.1.19490 WP_000836780.1.19493 WP_000836780.1.19510 WP_000836780.1.19532 WP_000836780.1.19558 WP_000836780.1.19721 WP_000836780.1.19729 WP_000836780.1.19832 WP_000836780.1.19856 WP_000836780.1.19925 WP_000836780.1.1996 WP_000836780.1.20079 WP_000836780.1.20124 WP_000836780.1.20139 WP_000836780.1.20227 WP_000836780.1.20279 WP_000836780.1.20298 WP_000836780.1.20328 WP_000836780.1.20374 WP_000836780.1.20382 WP_000836780.1.20408 WP_000836780.1.2048 WP_000836780.1.20486 WP_000836780.1.20491 WP_000836780.1.20634 WP_000836780.1.20671 WP_000836780.1.20681 WP_000836780.1.20781 WP_000836780.1.20856 WP_000836780.1.20858 WP_000836780.1.20909 WP_000836780.1.20969 WP_000836780.1.20976 WP_000836780.1.21028 WP_000836780.1.21090 WP_000836780.1.21192 WP_000836780.1.21244 WP_000836780.1.21329 WP_000836780.1.21331 WP_000836780.1.21370 WP_000836780.1.21422 WP_000836780.1.21435 WP_000836780.1.21445 WP_000836780.1.21452 WP_000836780.1.2147 WP_000836780.1.21490 WP_000836780.1.2152 WP_000836780.1.21551 WP_000836780.1.21599 WP_000836780.1.21604 WP_000836780.1.21620 WP_000836780.1.21675 WP_000836780.1.21682 WP_000836780.1.21691 WP_000836780.1.2173 WP_000836780.1.21753 WP_000836780.1.21790 WP_000836780.1.21807 WP_000836780.1.21816 WP_000836780.1.21822 WP_000836780.1.21885 WP_000836780.1.21979 WP_000836780.1.21997 WP_000836780.1.21998 WP_000836780.1.22014 WP_000836780.1.2203 WP_000836780.1.22058 WP_000836780.1.22083 WP_000836780.1.22119 WP_000836780.1.22122 WP_000836780.1.22135 WP_000836780.1.22196 WP_000836780.1.22262 WP_000836780.1.22297 WP_000836780.1.22338 WP_000836780.1.22341 WP_000836780.1.22457 WP_000836780.1.22459 WP_000836780.1.22480 WP_000836780.1.22503 WP_000836780.1.2255 WP_000836780.1.22561 WP_000836780.1.22616 WP_000836780.1.22637 WP_000836780.1.22723 WP_000836780.1.22784 WP_000836780.1.22839 WP_000836780.1.22941 WP_000836780.1.2296 WP_000836780.1.22976 WP_000836780.1.23025 WP_000836780.1.23031 WP_000836780.1.23083 WP_000836780.1.2311 WP_000836780.1.23177 WP_000836780.1.23354 WP_000836780.1.23397 WP_000836780.1.23432 WP_000836780.1.23606 WP_000836780.1.23649 WP_000836780.1.23656 WP_000836780.1.23696 WP_000836780.1.23713 WP_000836780.1.23742 WP_000836780.1.23791 WP_000836780.1.23798 WP_000836780.1.23853 WP_000836780.1.23889 WP_000836780.1.23903 WP_000836780.1.23966 WP_000836780.1.23968 WP_000836780.1.23978 WP_000836780.1.23991 WP_000836780.1.24067 WP_000836780.1.24116 WP_000836780.1.24146 WP_000836780.1.24222 WP_000836780.1.2429 WP_000836780.1.24312 WP_000836780.1.24318 WP_000836780.1.24395 WP_000836780.1.2444 WP_000836780.1.24440 WP_000836780.1.24481 WP_000836780.1.24540 WP_000836780.1.24573 WP_000836780.1.24574 WP_000836780.1.2459 WP_000836780.1.24620 WP_000836780.1.24627 WP_000836780.1.2465 WP_000836780.1.24788 WP_000836780.1.24835 WP_000836780.1.24852 WP_000836780.1.24871 WP_000836780.1.24970 WP_000836780.1.2503 WP_000836780.1.25121 WP_000836780.1.25139 WP_000836780.1.25202 WP_000836780.1.25226 WP_000836780.1.25293 WP_000836780.1.25337 WP_000836780.1.25383 WP_000836780.1.25424 WP_000836780.1.25439 WP_000836780.1.25442 WP_000836780.1.25461 WP_000836780.1.25494 WP_000836780.1.25571 WP_000836780.1.25624 WP_000836780.1.25662 WP_000836780.1.25684 WP_000836780.1.25685 WP_000836780.1.25749 WP_000836780.1.25771 WP_000836780.1.25783 WP_000836780.1.2586 WP_000836780.1.25958 WP_000836780.1.25982 WP_000836780.1.25986 WP_000836780.1.25994 WP_000836780.1.26041 WP_000836780.1.2610 WP_000836780.1.26165 WP_000836780.1.26218 WP_000836780.1.26220 WP_000836780.1.26280 WP_000836780.1.26317 WP_000836780.1.26369 WP_000836780.1.26496 WP_000836780.1.26578 WP_000836780.1.26781 WP_000836780.1.26799 WP_000836780.1.26823 WP_000836780.1.26855 WP_000836780.1.26901 WP_000836780.1.26968 WP_000836780.1.26990 WP_000836780.1.27001 WP_000836780.1.27022 WP_000836780.1.27119 WP_000836780.1.27174 WP_000836780.1.2721 WP_000836780.1.27219 WP_000836780.1.2724 WP_000836780.1.27324 WP_000836780.1.27432 WP_000836780.1.27484 WP_000836780.1.27581 WP_000836780.1.27589 WP_000836780.1.276 WP_000836780.1.27601 WP_000836780.1.27610 WP_000836780.1.27636 WP_000836780.1.27661 WP_000836780.1.27746 WP_000836780.1.27759 WP_000836780.1.27829 WP_000836780.1.2786 WP_000836780.1.27912 WP_000836780.1.28014 WP_000836780.1.28058 WP_000836780.1.28089 WP_000836780.1.28146 WP_000836780.1.28183 WP_000836780.1.28259 WP_000836780.1.28264 WP_000836780.1.2830 WP_000836780.1.28307 WP_000836780.1.28353 WP_000836780.1.28408 WP_000836780.1.28458 WP_000836780.1.28519 WP_000836780.1.28537 WP_000836780.1.28542 WP_000836780.1.28572 WP_000836780.1.28659 WP_000836780.1.2868 WP_000836780.1.28746 WP_000836780.1.28767 WP_000836780.1.28986 WP_000836780.1.29009 WP_000836780.1.2909 WP_000836780.1.29104 WP_000836780.1.29192 WP_000836780.1.29210 WP_000836780.1.29232 WP_000836780.1.29249 WP_000836780.1.29253 WP_000836780.1.29269 WP_000836780.1.29289 WP_000836780.1.29406 WP_000836780.1.29442 WP_000836780.1.29473 WP_000836780.1.29536 WP_000836780.1.29687 WP_000836780.1.29694 WP_000836780.1.29712 WP_000836780.1.29810 WP_000836780.1.29828 WP_000836780.1.29852 WP_000836780.1.29881 WP_000836780.1.29921 WP_000836780.1.29944 WP_000836780.1.29980 WP_000836780.1.30038 WP_000836780.1.30055 WP_000836780.1.3008 WP_000836780.1.3011 WP_000836780.1.30119 WP_000836780.1.30133 WP_000836780.1.30134 WP_000836780.1.30151 WP_000836780.1.30229 WP_000836780.1.30234 WP_000836780.1.30287 WP_000836780.1.30290 WP_000836780.1.30301 WP_000836780.1.30335 WP_000836780.1.30342 WP_000836780.1.30480 WP_000836780.1.30481 WP_000836780.1.30514 WP_000836780.1.30543 WP_000836780.1.30545 WP_000836780.1.30553 WP_000836780.1.30564 WP_000836780.1.3058 WP_000836780.1.30588 WP_000836780.1.30591 WP_000836780.1.30612 WP_000836780.1.30711 WP_000836780.1.30795 WP_000836780.1.30869 WP_000836780.1.30933 WP_000836780.1.30948 WP_000836780.1.31004 WP_000836780.1.31059 WP_000836780.1.31169 WP_000836780.1.31275 WP_000836780.1.31276 WP_000836780.1.31427 WP_000836780.1.31466 WP_000836780.1.31473 WP_000836780.1.31493 WP_000836780.1.3152 WP_000836780.1.31545 WP_000836780.1.31586 WP_000836780.1.3161 WP_000836780.1.31620 WP_000836780.1.31652 WP_000836780.1.31695 WP_000836780.1.31876 WP_000836780.1.31887 WP_000836780.1.3191 WP_000836780.1.31915 WP_000836780.1.31935 WP_000836780.1.31979 WP_000836780.1.31989 WP_000836780.1.320 WP_000836780.1.32035 WP_000836780.1.32058 WP_000836780.1.32080 WP_000836780.1.32083 WP_000836780.1.32097 WP_000836780.1.32117 WP_000836780.1.32280 WP_000836780.1.32397 WP_000836780.1.3241 WP_000836780.1.32439 WP_000836780.1.32485 WP_000836780.1.32540 WP_000836780.1.32606 WP_000836780.1.32696 WP_000836780.1.32717 WP_000836780.1.32734 WP_000836780.1.32816 WP_000836780.1.32876 WP_000836780.1.32924 WP_000836780.1.32994 WP_000836780.1.33021 WP_000836780.1.33070 WP_000836780.1.33072 WP_000836780.1.33113 WP_000836780.1.33135 WP_000836780.1.33166 WP_000836780.1.33180 WP_000836780.1.33182 WP_000836780.1.33359 WP_000836780.1.33361 WP_000836780.1.33436 WP_000836780.1.33451 WP_000836780.1.33454 WP_000836780.1.33528 WP_000836780.1.3359 WP_000836780.1.33666 WP_000836780.1.33709 WP_000836780.1.33727 WP_000836780.1.33807 WP_000836780.1.33815 WP_000836780.1.33878 WP_000836780.1.33881 WP_000836780.1.33897 WP_000836780.1.33908 WP_000836780.1.33923 WP_000836780.1.33933 WP_000836780.1.33960 WP_000836780.1.34028 WP_000836780.1.34176 WP_000836780.1.34262 WP_000836780.1.3427 WP_000836780.1.34291 WP_000836780.1.34327 WP_000836780.1.3433 WP_000836780.1.34335 WP_000836780.1.34449 WP_000836780.1.34503 WP_000836780.1.34601 WP_000836780.1.34662 WP_000836780.1.34713 WP_000836780.1.34742 WP_000836780.1.34754 WP_000836780.1.34785 WP_000836780.1.34787 WP_000836780.1.34899 WP_000836780.1.35042 WP_000836780.1.35064 WP_000836780.1.35103 WP_000836780.1.35117 WP_000836780.1.35133 WP_000836780.1.35152 WP_000836780.1.35167 WP_000836780.1.35178 WP_000836780.1.35232 WP_000836780.1.35248 WP_000836780.1.35305 WP_000836780.1.35383 WP_000836780.1.35392 WP_000836780.1.35459 WP_000836780.1.35528 WP_000836780.1.35614 WP_000836780.1.35616 WP_000836780.1.35625 WP_000836780.1.35634 WP_000836780.1.35655 WP_000836780.1.35708 WP_000836780.1.3571 WP_000836780.1.35727 WP_000836780.1.35763 WP_000836780.1.35920 WP_000836780.1.35925 WP_000836780.1.35960 WP_000836780.1.35986 WP_000836780.1.36054 WP_000836780.1.36060 WP_000836780.1.36139 WP_000836780.1.36162 WP_000836780.1.3618 WP_000836780.1.36206 WP_000836780.1.3621 WP_000836780.1.36242 WP_000836780.1.36377 WP_000836780.1.3638 WP_000836780.1.36404 WP_000836780.1.36463 WP_000836780.1.36492 WP_000836780.1.36546 WP_000836780.1.36554 WP_000836780.1.36651 WP_000836780.1.36688 WP_000836780.1.36715 WP_000836780.1.36750 WP_000836780.1.36757 WP_000836780.1.36867 WP_000836780.1.36961 WP_000836780.1.36965 WP_000836780.1.36993 WP_000836780.1.37033 WP_000836780.1.37115 WP_000836780.1.37136 WP_000836780.1.37166 WP_000836780.1.37205 WP_000836780.1.37227 WP_000836780.1.37243 WP_000836780.1.37280 WP_000836780.1.37282 WP_000836780.1.37300 WP_000836780.1.37324 WP_000836780.1.37340 WP_000836780.1.37346 WP_000836780.1.37357 WP_000836780.1.37540 WP_000836780.1.37575 WP_000836780.1.37623 WP_000836780.1.37696 WP_000836780.1.37707 WP_000836780.1.37713 WP_000836780.1.3780 WP_000836780.1.37944 WP_000836780.1.38014 WP_000836780.1.38093 WP_000836780.1.38184 WP_000836780.1.38216 WP_000836780.1.38268 WP_000836780.1.3844 WP_000836780.1.38465 WP_000836780.1.38506 WP_000836780.1.38507 WP_000836780.1.38519 WP_000836780.1.38573 WP_000836780.1.38588 WP_000836780.1.38605 WP_000836780.1.3864 WP_000836780.1.38695 WP_000836780.1.38712 WP_000836780.1.38778 WP_000836780.1.38855 WP_000836780.1.38860 WP_000836780.1.38887 WP_000836780.1.38918 WP_000836780.1.38934 WP_000836780.1.38955 WP_000836780.1.39006 WP_000836780.1.39033 WP_000836780.1.39051 WP_000836780.1.39079 WP_000836780.1.39083 WP_000836780.1.39087 WP_000836780.1.39091 WP_000836780.1.39121 WP_000836780.1.3916 WP_000836780.1.39175 WP_000836780.1.39189 WP_000836780.1.392 WP_000836780.1.39219 WP_000836780.1.39227 WP_000836780.1.39292 WP_000836780.1.39304 WP_000836780.1.3932 WP_000836780.1.39322 WP_000836780.1.39339 WP_000836780.1.39343 WP_000836780.1.39431 WP_000836780.1.395 WP_000836780.1.39505 WP_000836780.1.39518 WP_000836780.1.39591 WP_000836780.1.39648 WP_000836780.1.3966 WP_000836780.1.39663 WP_000836780.1.39710 WP_000836780.1.39719 WP_000836780.1.39866 WP_000836780.1.39872 WP_000836780.1.39931 WP_000836780.1.39944 WP_000836780.1.39968 WP_000836780.1.39985 WP_000836780.1.39990 WP_000836780.1.400 WP_000836780.1.40007 WP_000836780.1.40022 WP_000836780.1.40027 WP_000836780.1.40050 WP_000836780.1.4008 WP_000836780.1.40106 WP_000836780.1.40128 WP_000836780.1.40239 WP_000836780.1.40296 WP_000836780.1.40303 WP_000836780.1.40306 WP_000836780.1.40327 WP_000836780.1.40526 WP_000836780.1.40578 WP_000836780.1.40602 WP_000836780.1.40682 WP_000836780.1.40736 WP_000836780.1.40737 WP_000836780.1.40826 WP_000836780.1.4084 WP_000836780.1.40879 WP_000836780.1.40889 WP_000836780.1.40960 WP_000836780.1.40977 WP_000836780.1.40986 WP_000836780.1.41010 WP_000836780.1.41047 WP_000836780.1.41186 WP_000836780.1.41209 WP_000836780.1.41317 WP_000836780.1.41327 WP_000836780.1.41387 WP_000836780.1.4143 WP_000836780.1.41450 WP_000836780.1.4147 WP_000836780.1.41551 WP_000836780.1.41737 WP_000836780.1.41775 WP_000836780.1.41787 WP_000836780.1.41801 WP_000836780.1.41823 WP_000836780.1.41827 WP_000836780.1.41892 WP_000836780.1.41902 WP_000836780.1.41914 WP_000836780.1.41932 WP_000836780.1.41961 WP_000836780.1.4201 WP_000836780.1.42024 WP_000836780.1.42034 WP_000836780.1.42173 WP_000836780.1.42204 WP_000836780.1.42315 WP_000836780.1.42348 WP_000836780.1.42450 WP_000836780.1.42500 WP_000836780.1.42536 WP_000836780.1.42566 WP_000836780.1.42611 WP_000836780.1.42715 WP_000836780.1.42743 WP_000836780.1.42792 WP_000836780.1.42817 WP_000836780.1.42873 WP_000836780.1.43015 WP_000836780.1.4302 WP_000836780.1.43045 WP_000836780.1.43051 WP_000836780.1.43059 WP_000836780.1.43074 WP_000836780.1.43150 WP_000836780.1.43186 WP_000836780.1.43197 WP_000836780.1.43205 WP_000836780.1.43210 WP_000836780.1.4328 WP_000836780.1.43294 WP_000836780.1.43302 WP_000836780.1.43367 WP_000836780.1.43496 WP_000836780.1.43527 WP_000836780.1.43537 WP_000836780.1.43539 WP_000836780.1.43558 WP_000836780.1.43580 WP_000836780.1.4364 WP_000836780.1.43741 WP_000836780.1.43774 WP_000836780.1.43792 WP_000836780.1.43870 WP_000836780.1.43889 WP_000836780.1.43900 WP_000836780.1.43910 WP_000836780.1.43932 WP_000836780.1.43972 WP_000836780.1.44019 WP_000836780.1.44073 WP_000836780.1.44091 WP_000836780.1.44138 WP_000836780.1.44156 WP_000836780.1.44209 WP_000836780.1.44227 WP_000836780.1.44293 WP_000836780.1.4432 WP_000836780.1.44329 WP_000836780.1.44335 WP_000836780.1.44379 WP_000836780.1.44403 WP_000836780.1.44421 WP_000836780.1.44439 WP_000836780.1.44462 WP_000836780.1.44496 WP_000836780.1.44574 WP_000836780.1.44682 WP_000836780.1.44699 WP_000836780.1.44789 WP_000836780.1.44825 WP_000836780.1.44835 WP_000836780.1.44844 WP_000836780.1.44872 WP_000836780.1.44890 WP_000836780.1.44894 WP_000836780.1.4491 WP_000836780.1.44995 WP_000836780.1.45006 WP_000836780.1.45023 WP_000836780.1.45082 WP_000836780.1.4512 WP_000836780.1.45179 WP_000836780.1.45207 WP_000836780.1.45220 WP_000836780.1.45224 WP_000836780.1.45276 WP_000836780.1.45346 WP_000836780.1.45357 WP_000836780.1.45417 WP_000836780.1.45505 WP_000836780.1.45539 WP_000836780.1.45639 WP_000836780.1.45687 WP_000836780.1.45825 WP_000836780.1.45886 WP_000836780.1.45905 WP_000836780.1.45993 WP_000836780.1.46022 WP_000836780.1.46206 WP_000836780.1.46296 WP_000836780.1.46470 WP_000836780.1.46480 WP_000836780.1.46498 WP_000836780.1.46565 WP_000836780.1.46607 WP_000836780.1.46634 WP_000836780.1.46640 WP_000836780.1.46665 WP_000836780.1.46673 WP_000836780.1.46683 WP_000836780.1.46716 WP_000836780.1.46784 WP_000836780.1.46884 WP_000836780.1.46915 WP_000836780.1.46966 WP_000836780.1.47043 WP_000836780.1.47091 WP_000836780.1.47114 WP_000836780.1.47133 WP_000836780.1.47168 WP_000836780.1.47213 WP_000836780.1.47256 WP_000836780.1.47272 WP_000836780.1.47327 WP_000836780.1.47338 WP_000836780.1.47351 WP_000836780.1.47394 WP_000836780.1.47409 WP_000836780.1.47415 WP_000836780.1.47452 WP_000836780.1.47596 WP_000836780.1.47651 WP_000836780.1.47657 WP_000836780.1.47766 WP_000836780.1.47771 WP_000836780.1.47785 WP_000836780.1.47806 WP_000836780.1.47853 WP_000836780.1.47923 WP_000836780.1.47977 WP_000836780.1.4804 WP_000836780.1.48112 WP_000836780.1.48171 WP_000836780.1.48213 WP_000836780.1.4822 WP_000836780.1.48232 WP_000836780.1.48257 WP_000836780.1.48420 WP_000836780.1.48447 WP_000836780.1.48589 WP_000836780.1.48604 WP_000836780.1.48613 WP_000836780.1.48619 WP_000836780.1.48669 WP_000836780.1.48762 WP_000836780.1.48800 WP_000836780.1.4882 WP_000836780.1.48867 WP_000836780.1.48890 WP_000836780.1.4895 WP_000836780.1.49008 WP_000836780.1.49025 WP_000836780.1.49038 WP_000836780.1.49074 WP_000836780.1.49115 WP_000836780.1.49122 WP_000836780.1.492 WP_000836780.1.49208 WP_000836780.1.49216 WP_000836780.1.49298 WP_000836780.1.49303 WP_000836780.1.49324 WP_000836780.1.4936 WP_000836780.1.49389 WP_000836780.1.49408 WP_000836780.1.49511 WP_000836780.1.49514 WP_000836780.1.49538 WP_000836780.1.49597 WP_000836780.1.49656 WP_000836780.1.49692 WP_000836780.1.49759 WP_000836780.1.49801 WP_000836780.1.49841 WP_000836780.1.49874 WP_000836780.1.49955 WP_000836780.1.49975 WP_000836780.1.5000 WP_000836780.1.50005 WP_000836780.1.50016 WP_000836780.1.50034 WP_000836780.1.50059 WP_000836780.1.50083 WP_000836780.1.50120 WP_000836780.1.50143 WP_000836780.1.50168 WP_000836780.1.502 WP_000836780.1.50244 WP_000836780.1.50263 WP_000836780.1.50315 WP_000836780.1.50396 WP_000836780.1.50442 WP_000836780.1.50454 WP_000836780.1.50580 WP_000836780.1.50582 WP_000836780.1.50603 WP_000836780.1.50615 WP_000836780.1.50621 WP_000836780.1.50628 WP_000836780.1.50637 WP_000836780.1.5065 WP_000836780.1.507 WP_000836780.1.50709 WP_000836780.1.50743 WP_000836780.1.50797 WP_000836780.1.50849 WP_000836780.1.50870 WP_000836780.1.50911 WP_000836780.1.50948 WP_000836780.1.50995 WP_000836780.1.51054 WP_000836780.1.51079 WP_000836780.1.51098 WP_000836780.1.51145 WP_000836780.1.5116 WP_000836780.1.5122 WP_000836780.1.51243 WP_000836780.1.51316 WP_000836780.1.51367 WP_000836780.1.51379 WP_000836780.1.51439 WP_000836780.1.51449 WP_000836780.1.51467 WP_000836780.1.51475 WP_000836780.1.51507 WP_000836780.1.51533 WP_000836780.1.51541 WP_000836780.1.51635 WP_000836780.1.51715 WP_000836780.1.51750 WP_000836780.1.51820 WP_000836780.1.51826 WP_000836780.1.51855 WP_000836780.1.5188 WP_000836780.1.51908 WP_000836780.1.5191 WP_000836780.1.52014 WP_000836780.1.52018 WP_000836780.1.52049 WP_000836780.1.5212 WP_000836780.1.52245 WP_000836780.1.52263 WP_000836780.1.52276 WP_000836780.1.52323 WP_000836780.1.52335 WP_000836780.1.5244 WP_000836780.1.52512 WP_000836780.1.52540 WP_000836780.1.5256 WP_000836780.1.5261 WP_000836780.1.52721 WP_000836780.1.52726 WP_000836780.1.52770 WP_000836780.1.52843 WP_000836780.1.52856 WP_000836780.1.52957 WP_000836780.1.52972 WP_000836780.1.5298 WP_000836780.1.53010 WP_000836780.1.53054 WP_000836780.1.53135 WP_000836780.1.53149 WP_000836780.1.53183 WP_000836780.1.53188 WP_000836780.1.53205 WP_000836780.1.53212 WP_000836780.1.53239 WP_000836780.1.53241 WP_000836780.1.53275 WP_000836780.1.53291 WP_000836780.1.53337 WP_000836780.1.53357 WP_000836780.1.53404 WP_000836780.1.53405 WP_000836780.1.53420 WP_000836780.1.53449 WP_000836780.1.53499 WP_000836780.1.5361 WP_000836780.1.53612 WP_000836780.1.53640 WP_000836780.1.53660 WP_000836780.1.53677 WP_000836780.1.53699 WP_000836780.1.53773 WP_000836780.1.53950 WP_000836780.1.54001 WP_000836780.1.5405 WP_000836780.1.54065 WP_000836780.1.54066 WP_000836780.1.54069 WP_000836780.1.54130 WP_000836780.1.5424 WP_000836780.1.543 WP_000836780.1.54337 WP_000836780.1.54349 WP_000836780.1.54372 WP_000836780.1.54376 WP_000836780.1.54402 WP_000836780.1.54483 WP_000836780.1.54515 WP_000836780.1.54529 WP_000836780.1.54559 WP_000836780.1.54576 WP_000836780.1.54650 WP_000836780.1.54658 WP_000836780.1.54680 WP_000836780.1.54762 WP_000836780.1.54840 WP_000836780.1.54922 WP_000836780.1.54932 WP_000836780.1.54938 WP_000836780.1.54997 WP_000836780.1.55035 WP_000836780.1.55039 WP_000836780.1.5504 WP_000836780.1.55053 WP_000836780.1.55066 WP_000836780.1.55107 WP_000836780.1.55207 WP_000836780.1.55244 WP_000836780.1.5528 WP_000836780.1.55292 WP_000836780.1.5537 WP_000836780.1.55409 WP_000836780.1.55426 WP_000836780.1.55499 WP_000836780.1.55523 WP_000836780.1.55525 WP_000836780.1.55531 WP_000836780.1.55534 WP_000836780.1.55605 WP_000836780.1.55685 WP_000836780.1.55708 WP_000836780.1.55716 WP_000836780.1.55726 WP_000836780.1.55736 WP_000836780.1.55756 WP_000836780.1.55761 WP_000836780.1.5578 WP_000836780.1.5586 WP_000836780.1.55879 WP_000836780.1.55947 WP_000836780.1.560 WP_000836780.1.56023 WP_000836780.1.56054 WP_000836780.1.56257 WP_000836780.1.56300 WP_000836780.1.56319 WP_000836780.1.56472 WP_000836780.1.56476 WP_000836780.1.56505 WP_000836780.1.56519 WP_000836780.1.56582 WP_000836780.1.56610 WP_000836780.1.56617 WP_000836780.1.56624 WP_000836780.1.56746 WP_000836780.1.56756 WP_000836780.1.56775 WP_000836780.1.5689 WP_000836780.1.56958 WP_000836780.1.56989 WP_000836780.1.57009 WP_000836780.1.57017 WP_000836780.1.57040 WP_000836780.1.57194 WP_000836780.1.57219 WP_000836780.1.57279 WP_000836780.1.57334 WP_000836780.1.57366 WP_000836780.1.57382 WP_000836780.1.57442 WP_000836780.1.57503 WP_000836780.1.57587 WP_000836780.1.57602 WP_000836780.1.57647 WP_000836780.1.57668 WP_000836780.1.57743 WP_000836780.1.57750 WP_000836780.1.57760 WP_000836780.1.5779 WP_000836780.1.57876 WP_000836780.1.57896 WP_000836780.1.57917 WP_000836780.1.5793 WP_000836780.1.57977 WP_000836780.1.58013 WP_000836780.1.58020 WP_000836780.1.58021 WP_000836780.1.58034 WP_000836780.1.58076 WP_000836780.1.58124 WP_000836780.1.5813 WP_000836780.1.58171 WP_000836780.1.5819 WP_000836780.1.58196 WP_000836780.1.58197 WP_000836780.1.58217 WP_000836780.1.58225 WP_000836780.1.58227 WP_000836780.1.58243 WP_000836780.1.58331 WP_000836780.1.58344 WP_000836780.1.58402 WP_000836780.1.58434 WP_000836780.1.58458 WP_000836780.1.58483 WP_000836780.1.58553 WP_000836780.1.58563 WP_000836780.1.58607 WP_000836780.1.58642 WP_000836780.1.58653 WP_000836780.1.58738 WP_000836780.1.58854 WP_000836780.1.58959 WP_000836780.1.59018 WP_000836780.1.59028 WP_000836780.1.59066 WP_000836780.1.5916 WP_000836780.1.59198 WP_000836780.1.59229 WP_000836780.1.59235 WP_000836780.1.59435 WP_000836780.1.59442 WP_000836780.1.59532 WP_000836780.1.59534 WP_000836780.1.59558 WP_000836780.1.59608 WP_000836780.1.59637 WP_000836780.1.59700 WP_000836780.1.59740 WP_000836780.1.59766 WP_000836780.1.59867 WP_000836780.1.59883 WP_000836780.1.6001 WP_000836780.1.60073 WP_000836780.1.60148 WP_000836780.1.60188 WP_000836780.1.60210 WP_000836780.1.60256 WP_000836780.1.60298 WP_000836780.1.60385 WP_000836780.1.60388 WP_000836780.1.60450 WP_000836780.1.6046 WP_000836780.1.60485 WP_000836780.1.60513 WP_000836780.1.60529 WP_000836780.1.60601 WP_000836780.1.60615 WP_000836780.1.60621 WP_000836780.1.60637 WP_000836780.1.60642 WP_000836780.1.60646 WP_000836780.1.60656 WP_000836780.1.60670 WP_000836780.1.60693 WP_000836780.1.60731 WP_000836780.1.6081 WP_000836780.1.60812 WP_000836780.1.60815 WP_000836780.1.60867 WP_000836780.1.6087 WP_000836780.1.60911 WP_000836780.1.6092 WP_000836780.1.60924 WP_000836780.1.60961 WP_000836780.1.60977 WP_000836780.1.61028 WP_000836780.1.61159 WP_000836780.1.61164 WP_000836780.1.61226 WP_000836780.1.61301 WP_000836780.1.61302 WP_000836780.1.61365 WP_000836780.1.61378 WP_000836780.1.6140 WP_000836780.1.61404 WP_000836780.1.61423 WP_000836780.1.61451 WP_000836780.1.61471 WP_000836780.1.61513 WP_000836780.1.61548 WP_000836780.1.61560 WP_000836780.1.61606 WP_000836780.1.61627 WP_000836780.1.61632 WP_000836780.1.61651 WP_000836780.1.61675 WP_000836780.1.61735 WP_000836780.1.6183 WP_000836780.1.61882 WP_000836780.1.61954 WP_000836780.1.61992 WP_000836780.1.62001 WP_000836780.1.62006 WP_000836780.1.62039 WP_000836780.1.62118 WP_000836780.1.62129 WP_000836780.1.62137 WP_000836780.1.62167 WP_000836780.1.62197 WP_000836780.1.62220 WP_000836780.1.62235 WP_000836780.1.6226 WP_000836780.1.62287 WP_000836780.1.62356 WP_000836780.1.62390 WP_000836780.1.62391 WP_000836780.1.62394 WP_000836780.1.62417 WP_000836780.1.62420 WP_000836780.1.62421 WP_000836780.1.62444 WP_000836780.1.62465 WP_000836780.1.62521 WP_000836780.1.62540 WP_000836780.1.62558 WP_000836780.1.62566 WP_000836780.1.62613 WP_000836780.1.62803 WP_000836780.1.62814 WP_000836780.1.62821 WP_000836780.1.62862 WP_000836780.1.63033 WP_000836780.1.63075 WP_000836780.1.63077 WP_000836780.1.6309 WP_000836780.1.63149 WP_000836780.1.63214 WP_000836780.1.63329 WP_000836780.1.6341 WP_000836780.1.63468 WP_000836780.1.63506 WP_000836780.1.63543 WP_000836780.1.63621 WP_000836780.1.63787 WP_000836780.1.63788 WP_000836780.1.63891 WP_000836780.1.63927 WP_000836780.1.6393 WP_000836780.1.63936 WP_000836780.1.63938 WP_000836780.1.63971 WP_000836780.1.64135 WP_000836780.1.6414 WP_000836780.1.64184 WP_000836780.1.64224 WP_000836780.1.64225 WP_000836780.1.64245 WP_000836780.1.64246 WP_000836780.1.64262 WP_000836780.1.64267 WP_000836780.1.64269 WP_000836780.1.64316 WP_000836780.1.64320 WP_000836780.1.64338 WP_000836780.1.64359 WP_000836780.1.64401 WP_000836780.1.6447 WP_000836780.1.64719 WP_000836780.1.64723 WP_000836780.1.64725 WP_000836780.1.6474 WP_000836780.1.64750 WP_000836780.1.64778 WP_000836780.1.64837 WP_000836780.1.64839 WP_000836780.1.64851 WP_000836780.1.64917 WP_000836780.1.64931 WP_000836780.1.6495 WP_000836780.1.64960 WP_000836780.1.6504 WP_000836780.1.65062 WP_000836780.1.65087 WP_000836780.1.65091 WP_000836780.1.65107 WP_000836780.1.65232 WP_000836780.1.65265 WP_000836780.1.6532 WP_000836780.1.65352 WP_000836780.1.65362 WP_000836780.1.65396 WP_000836780.1.65489 WP_000836780.1.65492 WP_000836780.1.65523 WP_000836780.1.65536 WP_000836780.1.65607 WP_000836780.1.65641 WP_000836780.1.65773 WP_000836780.1.65789 WP_000836780.1.65797 WP_000836780.1.65806 WP_000836780.1.65853 WP_000836780.1.65920 WP_000836780.1.65971 WP_000836780.1.66045 WP_000836780.1.66053 WP_000836780.1.66115 WP_000836780.1.66132 WP_000836780.1.66207 WP_000836780.1.66468 WP_000836780.1.66477 WP_000836780.1.66497 WP_000836780.1.66500 WP_000836780.1.66517 WP_000836780.1.66586 WP_000836780.1.66595 WP_000836780.1.66683 WP_000836780.1.66745 WP_000836780.1.66829 WP_000836780.1.66835 WP_000836780.1.66861 WP_000836780.1.66881 WP_000836780.1.66917 WP_000836780.1.66983 WP_000836780.1.67039 WP_000836780.1.67084 WP_000836780.1.67114 WP_000836780.1.67148 WP_000836780.1.67151 WP_000836780.1.67196 WP_000836780.1.67222 WP_000836780.1.67304 WP_000836780.1.67416 WP_000836780.1.67443 WP_000836780.1.67508 WP_000836780.1.67510 WP_000836780.1.67565 WP_000836780.1.67684 WP_000836780.1.67697 WP_000836780.1.6773 WP_000836780.1.67741 WP_000836780.1.67797 WP_000836780.1.67930 WP_000836780.1.6795 WP_000836780.1.67950 WP_000836780.1.67967 WP_000836780.1.68017 WP_000836780.1.68084 WP_000836780.1.68103 WP_000836780.1.6821 WP_000836780.1.68238 WP_000836780.1.68306 WP_000836780.1.68427 WP_000836780.1.68431 WP_000836780.1.68460 WP_000836780.1.68494 WP_000836780.1.68503 WP_000836780.1.68535 WP_000836780.1.68567 WP_000836780.1.68682 WP_000836780.1.68689 WP_000836780.1.68777 WP_000836780.1.68784 WP_000836780.1.68814 WP_000836780.1.68825 WP_000836780.1.6894 WP_000836780.1.68963 WP_000836780.1.690 WP_000836780.1.69005 WP_000836780.1.69037 WP_000836780.1.69052 WP_000836780.1.69063 WP_000836780.1.69116 WP_000836780.1.69137 WP_000836780.1.69149 WP_000836780.1.69211 WP_000836780.1.69235 WP_000836780.1.69241 WP_000836780.1.69285 WP_000836780.1.69313 WP_000836780.1.69321 WP_000836780.1.69431 WP_000836780.1.69493 WP_000836780.1.69499 WP_000836780.1.69512 WP_000836780.1.69531 WP_000836780.1.69543 WP_000836780.1.69591 WP_000836780.1.69623 WP_000836780.1.69671 WP_000836780.1.69695 WP_000836780.1.69739 WP_000836780.1.69866 WP_000836780.1.6988 WP_000836780.1.69905 WP_000836780.1.69940 WP_000836780.1.69962 WP_000836780.1.70020 WP_000836780.1.70051 WP_000836780.1.70056 WP_000836780.1.70064 WP_000836780.1.70073 WP_000836780.1.70156 WP_000836780.1.70159 WP_000836780.1.70192 WP_000836780.1.70199 WP_000836780.1.70224 WP_000836780.1.70275 WP_000836780.1.70316 WP_000836780.1.70360 WP_000836780.1.70400 WP_000836780.1.70430 WP_000836780.1.7047 WP_000836780.1.70520 WP_000836780.1.70524 WP_000836780.1.70535 WP_000836780.1.70536 WP_000836780.1.70538 WP_000836780.1.7057 WP_000836780.1.70620 WP_000836780.1.70629 WP_000836780.1.70630 WP_000836780.1.70707 WP_000836780.1.70766 WP_000836780.1.70838 WP_000836780.1.70867 WP_000836780.1.70942 WP_000836780.1.70987 WP_000836780.1.70988 WP_000836780.1.71020 WP_000836780.1.71051 WP_000836780.1.71082 WP_000836780.1.71177 WP_000836780.1.7123 WP_000836780.1.71415 WP_000836780.1.71534 WP_000836780.1.71551 WP_000836780.1.71659 WP_000836780.1.71675 WP_000836780.1.71700 WP_000836780.1.7173 WP_000836780.1.71758 WP_000836780.1.71773 WP_000836780.1.71869 WP_000836780.1.71870 WP_000836780.1.71880 WP_000836780.1.72009 WP_000836780.1.72043 WP_000836780.1.72088 WP_000836780.1.72115 WP_000836780.1.72135 WP_000836780.1.72407 WP_000836780.1.72416 WP_000836780.1.7247 WP_000836780.1.72474 WP_000836780.1.72542 WP_000836780.1.72565 WP_000836780.1.72630 WP_000836780.1.72705 WP_000836780.1.72769 WP_000836780.1.72785 WP_000836780.1.7289 WP_000836780.1.72922 WP_000836780.1.72926 WP_000836780.1.73012 WP_000836780.1.73027 WP_000836780.1.73058 WP_000836780.1.73065 WP_000836780.1.73071 WP_000836780.1.73089 WP_000836780.1.73101 WP_000836780.1.73227 WP_000836780.1.73322 WP_000836780.1.73369 WP_000836780.1.73384 WP_000836780.1.73419 WP_000836780.1.7347 WP_000836780.1.7352 WP_000836780.1.73525 WP_000836780.1.73548 WP_000836780.1.73554 WP_000836780.1.73568 WP_000836780.1.73588 WP_000836780.1.73593 WP_000836780.1.73622 WP_000836780.1.73666 WP_000836780.1.73851 WP_000836780.1.73912 WP_000836780.1.73982 WP_000836780.1.74009 WP_000836780.1.74014 WP_000836780.1.74105 WP_000836780.1.74128 WP_000836780.1.74208 WP_000836780.1.74220 WP_000836780.1.74231 WP_000836780.1.74314 WP_000836780.1.74331 WP_000836780.1.74363 WP_000836780.1.74387 WP_000836780.1.74396 WP_000836780.1.74443 WP_000836780.1.74471 WP_000836780.1.7449 WP_000836780.1.74537 WP_000836780.1.74548 WP_000836780.1.74582 WP_000836780.1.74618 WP_000836780.1.7466 WP_000836780.1.74796 WP_000836780.1.74848 WP_000836780.1.74855 WP_000836780.1.74877 WP_000836780.1.7488 WP_000836780.1.74891 WP_000836780.1.74974 WP_000836780.1.75049 WP_000836780.1.75074 WP_000836780.1.75142 WP_000836780.1.75203 WP_000836780.1.7527 WP_000836780.1.75284 WP_000836780.1.75325 WP_000836780.1.75336 WP_000836780.1.75464 WP_000836780.1.75490 WP_000836780.1.7554 WP_000836780.1.75582 WP_000836780.1.75648 WP_000836780.1.75675 WP_000836780.1.75729 WP_000836780.1.75752 WP_000836780.1.75787 WP_000836780.1.75834 WP_000836780.1.75897 WP_000836780.1.75904 WP_000836780.1.75976 WP_000836780.1.75996 WP_000836780.1.760 WP_000836780.1.76003 WP_000836780.1.76068 WP_000836780.1.76161 WP_000836780.1.76195 WP_000836780.1.76220 WP_000836780.1.76233 WP_000836780.1.76249 WP_000836780.1.76499 WP_000836780.1.76564 WP_000836780.1.76567 WP_000836780.1.76577 WP_000836780.1.76591 WP_000836780.1.76594 WP_000836780.1.76722 WP_000836780.1.76761 WP_000836780.1.7678 WP_000836780.1.7679 WP_000836780.1.76830 WP_000836780.1.76868 WP_000836780.1.76874 WP_000836780.1.76927 WP_000836780.1.76972 WP_000836780.1.77044 WP_000836780.1.77121 WP_000836780.1.77167 WP_000836780.1.77269 WP_000836780.1.7735 WP_000836780.1.77379 WP_000836780.1.77456 WP_000836780.1.77480 WP_000836780.1.77505 WP_000836780.1.77582 WP_000836780.1.7761 WP_000836780.1.77659 WP_000836780.1.77780 WP_000836780.1.77789 WP_000836780.1.77877 WP_000836780.1.77976 WP_000836780.1.78003 WP_000836780.1.78025 WP_000836780.1.78030 WP_000836780.1.78045 WP_000836780.1.78058 WP_000836780.1.78078 WP_000836780.1.78087 WP_000836780.1.7812 WP_000836780.1.78139 WP_000836780.1.78349 WP_000836780.1.7838 WP_000836780.1.78397 WP_000836780.1.78455 WP_000836780.1.78563 WP_000836780.1.78588 WP_000836780.1.78609 WP_000836780.1.78755 WP_000836780.1.7876 WP_000836780.1.78828 WP_000836780.1.78832 WP_000836780.1.78876 WP_000836780.1.78939 WP_000836780.1.78965 WP_000836780.1.78979 WP_000836780.1.7910 WP_000836780.1.79124 WP_000836780.1.79134 WP_000836780.1.79202 WP_000836780.1.79228 WP_000836780.1.79245 WP_000836780.1.79329 WP_000836780.1.79349 WP_000836780.1.79496 WP_000836780.1.79546 WP_000836780.1.79555 WP_000836780.1.79594 WP_000836780.1.79612 WP_000836780.1.79637 WP_000836780.1.79671 WP_000836780.1.79675 WP_000836780.1.79705 WP_000836780.1.79746 WP_000836780.1.79786 WP_000836780.1.79809 WP_000836780.1.79811 WP_000836780.1.79849 WP_000836780.1.79899 WP_000836780.1.7998 WP_000836780.1.80161 WP_000836780.1.80200 WP_000836780.1.80251 WP_000836780.1.80261 WP_000836780.1.80268 WP_000836780.1.80294 WP_000836780.1.80349 WP_000836780.1.80373 WP_000836780.1.80376 WP_000836780.1.80435 WP_000836780.1.80516 WP_000836780.1.80548 WP_000836780.1.80691 WP_000836780.1.80758 WP_000836780.1.80765 WP_000836780.1.80914 WP_000836780.1.80971 WP_000836780.1.8109 WP_000836780.1.81090 WP_000836780.1.81134 WP_000836780.1.81179 WP_000836780.1.81183 WP_000836780.1.81201 WP_000836780.1.81292 WP_000836780.1.81390 WP_000836780.1.81398 WP_000836780.1.81483 WP_000836780.1.815 WP_000836780.1.81534 WP_000836780.1.8154 WP_000836780.1.81573 WP_000836780.1.81663 WP_000836780.1.81716 WP_000836780.1.81724 WP_000836780.1.81745 WP_000836780.1.81769 WP_000836780.1.81775 WP_000836780.1.81801 WP_000836780.1.81890 WP_000836780.1.81894 WP_000836780.1.81929 WP_000836780.1.81959 WP_000836780.1.82042 WP_000836780.1.82051 WP_000836780.1.82085 WP_000836780.1.82159 WP_000836780.1.82189 WP_000836780.1.82195 WP_000836780.1.82252 WP_000836780.1.82279 WP_000836780.1.82306 WP_000836780.1.82407 WP_000836780.1.82459 WP_000836780.1.82481 WP_000836780.1.82505 WP_000836780.1.82518 WP_000836780.1.82528 WP_000836780.1.82537 WP_000836780.1.82666 WP_000836780.1.82699 WP_000836780.1.82750 WP_000836780.1.82771 WP_000836780.1.82792 WP_000836780.1.82827 WP_000836780.1.82839 WP_000836780.1.82877 WP_000836780.1.82885 WP_000836780.1.82900 WP_000836780.1.82921 WP_000836780.1.82970 WP_000836780.1.82994 WP_000836780.1.83055 WP_000836780.1.83094 WP_000836780.1.83107 WP_000836780.1.83135 WP_000836780.1.83168 WP_000836780.1.83169 WP_000836780.1.83174 WP_000836780.1.83183 WP_000836780.1.83242 WP_000836780.1.83278 WP_000836780.1.83281 WP_000836780.1.83306 WP_000836780.1.83311 WP_000836780.1.83335 WP_000836780.1.83403 WP_000836780.1.83414 WP_000836780.1.83443 WP_000836780.1.83455 WP_000836780.1.83456 WP_000836780.1.83518 WP_000836780.1.8352 WP_000836780.1.83565 WP_000836780.1.83578 WP_000836780.1.8360 WP_000836780.1.83606 WP_000836780.1.83702 WP_000836780.1.83713 WP_000836780.1.83789 WP_000836780.1.83796 WP_000836780.1.83888 WP_000836780.1.83898 WP_000836780.1.83910 WP_000836780.1.83934 WP_000836780.1.83978 WP_000836780.1.84013 WP_000836780.1.84038 WP_000836780.1.84061 WP_000836780.1.84065 WP_000836780.1.84113 WP_000836780.1.84147 WP_000836780.1.84225 WP_000836780.1.8423 WP_000836780.1.84321 WP_000836780.1.84505 WP_000836780.1.84513 WP_000836780.1.8454 WP_000836780.1.84576 WP_000836780.1.84640 WP_000836780.1.8481 WP_000836780.1.84827 WP_000836780.1.84998 WP_000836780.1.85019 WP_000836780.1.85033 WP_000836780.1.8506 WP_000836780.1.85061 WP_000836780.1.85062 WP_000836780.1.85095 WP_000836780.1.85103 WP_000836780.1.85171 WP_000836780.1.85195 WP_000836780.1.85215 WP_000836780.1.85286 WP_000836780.1.85370 WP_000836780.1.85427 WP_000836780.1.85496 WP_000836780.1.85548 WP_000836780.1.85552 WP_000836780.1.85581 WP_000836780.1.85609 WP_000836780.1.85629 WP_000836780.1.85652 WP_000836780.1.85748 WP_000836780.1.85760 WP_000836780.1.85789 WP_000836780.1.85849 WP_000836780.1.85881 WP_000836780.1.85882 WP_000836780.1.85942 WP_000836780.1.85973 WP_000836780.1.86020 WP_000836780.1.86081 WP_000836780.1.8612 WP_000836780.1.86211 WP_000836780.1.86238 WP_000836780.1.86296 WP_000836780.1.86313 WP_000836780.1.86320 WP_000836780.1.86407 WP_000836780.1.86423 WP_000836780.1.8646 WP_000836780.1.86539 WP_000836780.1.86558 WP_000836780.1.86612 WP_000836780.1.86632 WP_000836780.1.86689 WP_000836780.1.86723 WP_000836780.1.8674 WP_000836780.1.86742 WP_000836780.1.86747 WP_000836780.1.86751 WP_000836780.1.86866 WP_000836780.1.86918 WP_000836780.1.87065 WP_000836780.1.87138 WP_000836780.1.87289 WP_000836780.1.87331 WP_000836780.1.87332 WP_000836780.1.8734 WP_000836780.1.87352 WP_000836780.1.87422 WP_000836780.1.87510 WP_000836780.1.87521 WP_000836780.1.87604 WP_000836780.1.87621 WP_000836780.1.87774 WP_000836780.1.87775 WP_000836780.1.87792 WP_000836780.1.87815 WP_000836780.1.87824 WP_000836780.1.87829 WP_000836780.1.87839 WP_000836780.1.87863 WP_000836780.1.87868 WP_000836780.1.87901 WP_000836780.1.87904 WP_000836780.1.87909 WP_000836780.1.87910 WP_000836780.1.87971 WP_000836780.1.87998 WP_000836780.1.88008 WP_000836780.1.88054 WP_000836780.1.88103 WP_000836780.1.88129 WP_000836780.1.88167 WP_000836780.1.88170 WP_000836780.1.88176 WP_000836780.1.88224 WP_000836780.1.88254 WP_000836780.1.88365 WP_000836780.1.88391 WP_000836780.1.88519 WP_000836780.1.88523 WP_000836780.1.88544 WP_000836780.1.88652 WP_000836780.1.88669 WP_000836780.1.88693 WP_000836780.1.88697 WP_000836780.1.88700 WP_000836780.1.88722 WP_000836780.1.88825 WP_000836780.1.88841 WP_000836780.1.88862 WP_000836780.1.88869 WP_000836780.1.88904 WP_000836780.1.88963 WP_000836780.1.88984 WP_000836780.1.89029 WP_000836780.1.89032 WP_000836780.1.89057 WP_000836780.1.89094 WP_000836780.1.89208 WP_000836780.1.8930 WP_000836780.1.89370 WP_000836780.1.89444 WP_000836780.1.89493 WP_000836780.1.89504 WP_000836780.1.89532 WP_000836780.1.89563 WP_000836780.1.89620 WP_000836780.1.89652 WP_000836780.1.89763 WP_000836780.1.89837 WP_000836780.1.89850 WP_000836780.1.89858 WP_000836780.1.89875 WP_000836780.1.89887 WP_000836780.1.89891 WP_000836780.1.89905 WP_000836780.1.89967 WP_000836780.1.89982 WP_000836780.1.90059 WP_000836780.1.90143 WP_000836780.1.90158 WP_000836780.1.90304 WP_000836780.1.90313 WP_000836780.1.90385 WP_000836780.1.90396 WP_000836780.1.90410 WP_000836780.1.90425 WP_000836780.1.90443 WP_000836780.1.90597 WP_000836780.1.90615 WP_000836780.1.90628 WP_000836780.1.90678 WP_000836780.1.90712 WP_000836780.1.90727 WP_000836780.1.90762 WP_000836780.1.90768 WP_000836780.1.90778 WP_000836780.1.90809 WP_000836780.1.90869 WP_000836780.1.90894 WP_000836780.1.90897 WP_000836780.1.9090 WP_000836780.1.90925 WP_000836780.1.90929 WP_000836780.1.91099 WP_000836780.1.91178 WP_000836780.1.91193 WP_000836780.1.91269 WP_000836780.1.91271 WP_000836780.1.91388 WP_000836780.1.91407 WP_000836780.1.91413 WP_000836780.1.91432 WP_000836780.1.91686 WP_000836780.1.91705 WP_000836780.1.91718 WP_000836780.1.91815 WP_000836780.1.9184 WP_000836780.1.91924 WP_000836780.1.91927 WP_000836780.1.91934 WP_000836780.1.91947 WP_000836780.1.91960 WP_000836780.1.91985 WP_000836780.1.92006 WP_000836780.1.92010 WP_000836780.1.9207 WP_000836780.1.92092 WP_000836780.1.92103 WP_000836780.1.92182 WP_000836780.1.92187 WP_000836780.1.92225 WP_000836780.1.92271 WP_000836780.1.92301 WP_000836780.1.92353 WP_000836780.1.92389 WP_000836780.1.92457 WP_000836780.1.92491 WP_000836780.1.92502 WP_000836780.1.9260 WP_000836780.1.92640 WP_000836780.1.92724 WP_000836780.1.92732 WP_000836780.1.92812 WP_000836780.1.92866 WP_000836780.1.92872 WP_000836780.1.92874 WP_000836780.1.92896 WP_000836780.1.92906 WP_000836780.1.92962 WP_000836780.1.92967 WP_000836780.1.9297 WP_000836780.1.92971 WP_000836780.1.93075 WP_000836780.1.93084 WP_000836780.1.93129 WP_000836780.1.93158 WP_000836780.1.93173 WP_000836780.1.93210 WP_000836780.1.93262 WP_000836780.1.93281 WP_000836780.1.93294 WP_000836780.1.93314 WP_000836780.1.93347 WP_000836780.1.9339 WP_000836780.1.93398 WP_000836780.1.9345 WP_000836780.1.93452 WP_000836780.1.93479 WP_000836780.1.93515 WP_000836780.1.93522 WP_000836780.1.93606 WP_000836780.1.93636 WP_000836780.1.9364 WP_000836780.1.93641 WP_000836780.1.93680 WP_000836780.1.9369 WP_000836780.1.93703 WP_000836780.1.93814 WP_000836780.1.93865 WP_000836780.1.93869 WP_000836780.1.93906 WP_000836780.1.93974 WP_000836780.1.94024 WP_000836780.1.9403 WP_000836780.1.94061 WP_000836780.1.94090 WP_000836780.1.94104 WP_000836780.1.94148 WP_000836780.1.94263 WP_000836780.1.94334 WP_000836780.1.94357 WP_000836780.1.94425 WP_000836780.1.94459 WP_000836780.1.945 WP_000836780.1.94503 WP_000836780.1.94509 WP_000836780.1.94515 WP_000836780.1.94558 WP_000836780.1.94595 WP_000836780.1.94604 WP_000836780.1.94610 WP_000836780.1.94644 WP_000836780.1.94651 WP_000836780.1.94652 WP_000836780.1.94689 WP_000836780.1.94810 WP_000836780.1.94876 WP_000836780.1.94883 WP_000836780.1.94925 WP_000836780.1.95050 WP_000836780.1.95058 WP_000836780.1.95059 WP_000836780.1.95073 WP_000836780.1.95106 WP_000836780.1.95153 WP_000836780.1.95192 WP_000836780.1.95240 WP_000836780.1.9528 WP_000836780.1.95303 WP_000836780.1.95322 WP_000836780.1.95376 WP_000836780.1.95553 WP_000836780.1.95605 WP_000836780.1.95698 WP_000836780.1.95707 WP_000836780.1.95725 WP_000836780.1.95740 WP_000836780.1.95807 WP_000836780.1.95853 WP_000836780.1.95879 WP_000836780.1.95904 WP_000836780.1.96003 WP_000836780.1.96007 WP_000836780.1.96011 WP_000836780.1.96024 WP_000836780.1.96049 WP_000836780.1.96081 WP_000836780.1.96100 WP_000836780.1.96126 WP_000836780.1.9615 WP_000836780.1.96189 WP_000836780.1.96292 WP_000836780.1.96564 WP_000836780.1.96582 WP_000836780.1.96619 WP_000836780.1.96636 WP_000836780.1.96652 WP_000836780.1.96703 WP_000836780.1.96728 WP_000836780.1.96812 WP_000836780.1.96821 WP_000836780.1.96851 WP_000836780.1.96887 WP_000836780.1.97035 WP_000836780.1.97040 WP_000836780.1.97048 WP_000836780.1.9705 WP_000836780.1.97187 WP_000836780.1.97485 WP_000836780.1.97553 WP_000836780.1.97644 WP_000836780.1.97657 WP_000836780.1.97686 WP_000836780.1.97702 WP_000836780.1.97808 WP_000836780.1.97831 WP_000836780.1.97856 WP_000836780.1.97862 WP_000836780.1.97875 WP_000836780.1.97878 WP_000836780.1.97886 WP_000836780.1.97891 WP_000836780.1.97901 WP_000836780.1.97931 WP_000836780.1.98049 WP_000836780.1.98084 WP_000836780.1.9812 WP_000836780.1.98217 WP_000836780.1.98234 WP_000836780.1.98245 WP_000836780.1.98265 WP_000836780.1.98270 WP_000836780.1.98277 WP_000836780.1.98399 WP_000836780.1.98475 WP_000836780.1.98518 WP_000836780.1.98632 WP_000836780.1.98635 WP_000836780.1.98647 WP_000836780.1.98648 WP_000836780.1.98679 WP_000836780.1.98732 WP_000836780.1.98781 WP_000836780.1.98855 WP_000836780.1.98862 WP_000836780.1.98905 WP_000836780.1.98915 WP_000836780.1.98990 WP_000836780.1.99028 WP_000836780.1.99034 WP_000836780.1.99096 WP_000836780.1.99114 WP_000836780.1.99138 WP_000836780.1.99148 WP_000836780.1.9915 WP_000836780.1.99181 WP_000836780.1.99314 WP_000836780.1.99342 WP_000836780.1.99371 WP_000836780.1.99436 WP_000836780.1.99687 WP_000836780.1.99853 gi|410475950|ref|YP_006742709.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]