SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|194397387|ref|YP_002038604.1| from Streptococcus pneumoniae G54

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|194397387|ref|YP_002038604.1|
Domain Number 1 Region: 1-100
Classification Level Classification E-value
Superfamily Enzyme IIa from lactose specific PTS, IIa-lac 3.14e-32
Family Enzyme IIa from lactose specific PTS, IIa-lac 0.00043
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|194397387|ref|YP_002038604.1|
Sequence length 102
Comment PTS system transporter subunit IIA [Streptococcus pneumoniae G54]
Sequence
MTEEMEYICFQLIANSGAAKSSFIEAIQLAKAGNLKEAKIKVEEAEDSLVEAHKIHSNLI
QKEATGEKIGFSLLFMHAEDQMASTEIIQLLSKEFIDLYQNK
Download sequence
Identical sequences A0A064C471 A0A0H2ZR72 A0A0T9FE73 A5LNY1 A5MAR3 B1I981 C1CA69 C1CGV4 D6ZMS6 G6JDB4 G6LQG0 M5KBC8 M5KD05 M5MYI4
gi|225859780|ref|YP_002741290.1| gi|387760112|ref|YP_006067090.1| 373153.SPD_1833 487213.SPT_2020 487214.SPH_2178 488221.SP70585_2110 488222.SPJ_2030 488223.SPP_2061 512566.SPG_1937 561276.SPN23F_20450 WP_000134124.1.101577 WP_000134124.1.46966 WP_000134124.1.49628 WP_000134124.1.5242 WP_000134124.1.6137 WP_000134124.1.61386 WP_000134124.1.6773 WP_000134124.1.83776 WP_000134124.1.99760 gi|387627174|ref|YP_006063350.1| gi|307068636|ref|YP_003877602.1| gi|307128225|ref|YP_003880256.1| gi|480532962|ref|YP_007765165.1| gi|225857598|ref|YP_002739109.1| gi|480535598|ref|YP_007813508.1| gi|116516943|ref|YP_817240.1| gi|194397387|ref|YP_002038604.1| gi|387758192|ref|YP_006065171.1| gi|221232743|ref|YP_002511897.1| gi|405760106|ref|YP_006700702.1| gi|480531978|ref|YP_007764182.1| gi|480537419|ref|YP_007815328.1| gi|225855513|ref|YP_002737025.1| gi|298501521|ref|YP_003723461.1| gi|169832944|ref|YP_001695376.1| gi|225861844|ref|YP_002743353.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]