SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|186470460|ref|YP_001861778.1| from Burkholderia phymatum STM815

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|186470460|ref|YP_001861778.1|
Domain Number 1 Region: 629-805
Classification Level Classification E-value
Superfamily Nitrite and sulphite reductase 4Fe-4S domain-like 1.7e-50
Family Nitrite and sulphite reductase 4Fe-4S domain-like 0.0021
Further Details:      
 
Domain Number 2 Region: 1-305
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 4.47e-40
Family FAD/NAD-linked reductases, N-terminal and central domains 0.0052
Further Details:      
 
Domain Number 3 Region: 498-637
Classification Level Classification E-value
Superfamily Nitrite/Sulfite reductase N-terminal domain-like 2.13e-27
Family Duplicated SiR/NiR-like domains 1 and 3 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|186470460|ref|YP_001861778.1|
Sequence length 854
Comment nitrite reductase (NAD(P)H) large subunit [Burkholderia phymatum STM815]
Sequence
MKVIVIGHGMVGHKLLECLAEQSAARLDITVLCEEPRPAYDRVHLSEFFSGKSADDLSLV
APGFFDRDDMVLRLNAKAVSIDRHAHTVSTSTGETLAYDKLVIASGSYAFVPPVPGRDRQ
DCFVYRTIEDLEAMQECGARSKRGVVVGGGLLGLECAKALRDMGLDTHVVEFAPRLMAVQ
VDDGGGKTLRGKIEELGVTVHTQKNTLEIVDGEEGTHRMQFADGSHLDTDMIVFSAGIRP
RDEIARASGLDVGPRGGIVIDNHCRTSDADIYAIGECALWNGQIFGLVAPGYEMARVTAK
QLLGEQDAAFAGADMSTKLKLMGVDVASLGDAHGSTAGSRTYQFSDERKQVYKKLVVSEC
GKYLLGGVMVGDAREYGTLLQMMLNRIELPESPEFLILPQADGNAKPALGVDALPESAQI
CSCNNISKGAICASVCAGATTIGDVKNATKAGTACGGCVPLVTQVMKAEMKKQGLAVNNH
LCEHFPFSRQELYHIVRVERIKTFGALLEKHGHGLGCDICKPAVAGILASCWNEFVLKKE
HASLQDSNDYYLANIQRDGTYSVVPRMPGGEVTPEGLIAVGQVAQKYGLYTKITGGQRVD
LFGARVEQLPSIWEELIAAGFESGHAYGKSVRTVKSCVGSTWCRYGVDDSVGLAIDIENR
YKGLRSPHKLKFAVSGCTRECAEAQSKDVGIIATEKGWNLYVCGNGGMKPRHAELIASDL
DRDTLVCYIDRFLMFYVRTADRLQRTSVWRENLEGGLDYLKDVIVHDKLGIAAELEADMR
HVVDTYECEWKKAVTDPETRKRFRHFVNSDSADDNISFVATRGQIRPASPDERQQRPVRI
PVVVEQSTEPAETA
Download sequence
Identical sequences B2JUV4
gi|186470460|ref|YP_001861778.1|NC_010625 gi|186470460|ref|YP_001861778.1| WP_012404892.1.55900 391038.Bphy_5659

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]