SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|186470623|ref|YP_001861941.1| from Burkholderia phymatum STM815

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|186470623|ref|YP_001861941.1|
Domain Number 1 Region: 143-300
Classification Level Classification E-value
Superfamily Nitrite and sulphite reductase 4Fe-4S domain-like 2.09e-45
Family Nitrite and sulphite reductase 4Fe-4S domain-like 0.00052
Further Details:      
 
Domain Number 2 Region: 439-586
Classification Level Classification E-value
Superfamily Nitrite and sulphite reductase 4Fe-4S domain-like 5.63e-37
Family Nitrite and sulphite reductase 4Fe-4S domain-like 0.0008
Further Details:      
 
Domain Number 3 Region: 345-451
Classification Level Classification E-value
Superfamily Nitrite/Sulfite reductase N-terminal domain-like 1.8e-20
Family Duplicated SiR/NiR-like domains 1 and 3 0.01
Further Details:      
 
Domain Number 4 Region: 1-149
Classification Level Classification E-value
Superfamily Nitrite/Sulfite reductase N-terminal domain-like 2.04e-18
Family Duplicated SiR/NiR-like domains 1 and 3 0.023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|186470623|ref|YP_001861941.1|
Sequence length 596
Comment sulfite reductase (ferredoxin) [Burkholderia phymatum STM815]
Sequence
MYQYNEFDKAFLLNRAAQFRDQIERWQDGRLSEDAFRPLRLQNGWYVQRHAPMLRVAVPY
GELSSAQLRVLARVAREYDAPEADVYRQALDAQRKLGTVRLPTHHAHFTTRTNVQFNWIP
LAKAADVMDLLATVDMHGIQTSGNCIRNISCDERAGVAPDEIADPRPFAEIMRQWTTLHP
EFAFLPRKFKIAITGADDDRAATQWHDVGLRLRRGENGELGFRVTVGGGMGRTPVIGTVL
REFLPWQHIMNYIEAVVRVYNQYGRRDNKYKARIKILVKAEGQKYIDEVEEEFRQIVEHD
GGPHTIPRGELERVSAYFAQPVADSVARPVDPAARQAIHDAALHNPPFARWLKRNVARHK
NPLLCIVTLSFKRLLQAPGDASADQLDHLADLVDSFSAGEARVTHTQNIVLPWVHENDLL
ALWEAAREVGLASANVNLLTDMIACPGGDFCALANARSLPISQAITERYQDMDELEDIGE
VDLHISGCINSCGHHHSGHIGILGVDKDGSEWYQVTLGGSDGSHASGDAQPGKVIGPSFS
AHEVPDVIEAVLRTYVERRTHSGSARETFIETVRRIGPEPFKAAAHAVRTPVEVPA
Download sequence
Identical sequences B2JVB8
391038.Bphy_5829 gi|186470623|ref|YP_001861941.1| WP_012405055.1.55900 gi|186470623|ref|YP_001861941.1|NC_010625

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]