SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|186472015|ref|YP_001859357.1| from Burkholderia phymatum STM815

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|186472015|ref|YP_001859357.1|
Domain Number 1 Region: 103-263
Classification Level Classification E-value
Superfamily Nitrite and sulphite reductase 4Fe-4S domain-like 5.62e-21
Family Nitrite and sulphite reductase 4Fe-4S domain-like 0.0042
Further Details:      
 
Domain Number 2 Region: 14-94
Classification Level Classification E-value
Superfamily Nitrite/Sulfite reductase N-terminal domain-like 0.0000000000000605
Family Duplicated SiR/NiR-like domains 1 and 3 0.02
Further Details:      
 
Domain Number 3 Region: 357-453
Classification Level Classification E-value
Superfamily Nitrite and sulphite reductase 4Fe-4S domain-like 0.00000000000034
Family Nitrite and sulphite reductase 4Fe-4S domain-like 0.002
Further Details:      
 
Domain Number 4 Region: 229-363
Classification Level Classification E-value
Superfamily Nitrite/Sulfite reductase N-terminal domain-like 0.00000000000654
Family Duplicated SiR/NiR-like domains 1 and 3 0.0031
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|186472015|ref|YP_001859357.1|
Sequence length 465
Comment precorrin-3B synthase [Burkholderia phymatum STM815]
Sequence
MNQAFHSSNAFPLRPSACPGLLRIVPALDGGICRVKLQRGELSATQALAIADAIDEHASG
IVDLTNRANLQLRGVKRGHENALIAALLGAALGPRDAAHAHADDVRNVMTSPAAGCDAHA
LYDTTALAAELLSLLQSDARCAALSPKFALLLDGGERLMMLDHPHDIWCSALHPRDHAEP
MFALGLAGCPPVLEGHPAALAAVPASELVALTRALLHTFLDLAAPDHTRMRDLLAKQSVE
SVLARAERESGVRLLRGQSIQSWRREPADASRRFGAWQQRDAHRDKQRWHIGGQPALGRV
NSATLRRLALLTKEQGATLRMTPWQSVLLTDIGTANLDATLQTLDALGLATTTDNPLTRV
IACAGSTGCVKSLADTKADAVKLAARLPDNTRVHLSGCPRSCAAAQCAPFTMLAAQNGRY
DLYHTHDPRESTGFGRLLARGLTIDEAADLLNASAAPPFDEPFDA
Download sequence
Identical sequences B2JRI4
391038.Bphy_3143 gi|186472015|ref|YP_001859357.1| WP_012402484.1.55900

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]