SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|186476986|ref|YP_001858456.1| from Burkholderia phymatum STM815

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|186476986|ref|YP_001858456.1|
Domain Number 1 Region: 120-285
Classification Level Classification E-value
Superfamily Nitrite and sulphite reductase 4Fe-4S domain-like 7.2e-47
Family Nitrite and sulphite reductase 4Fe-4S domain-like 0.00061
Further Details:      
 
Domain Number 2 Region: 409-554
Classification Level Classification E-value
Superfamily Nitrite and sulphite reductase 4Fe-4S domain-like 7.98e-41
Family Nitrite and sulphite reductase 4Fe-4S domain-like 0.00038
Further Details:      
 
Domain Number 3 Region: 1-126
Classification Level Classification E-value
Superfamily Nitrite/Sulfite reductase N-terminal domain-like 4.74e-30
Family Duplicated SiR/NiR-like domains 1 and 3 0.0063
Further Details:      
 
Domain Number 4 Region: 252-276,315-421
Classification Level Classification E-value
Superfamily Nitrite/Sulfite reductase N-terminal domain-like 6.05e-25
Family Duplicated SiR/NiR-like domains 1 and 3 0.0091
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|186476986|ref|YP_001858456.1|
Sequence length 559
Comment sulfite reductase [Burkholderia phymatum STM815]
Sequence
MYQYDQYDQTIVDERVAQYADQVRRRLSGELSEEEFRPLRLQNGLYMQRHAYMHRIAIPY
GNLRSDQLRMLATIAREHDRGYGHFSTRSNIQYNWIQLEDTPEILRKLASVQMHGIQTSG
NCIRNITADQFAGVAPDEIVDPRPWAEILRQWSTFHPEFAWLPRKFKIAVSGTKEDRAAV
QIHDLGVYLKKNAAGEVVASILAGGGLGRTPIIGAIIKQDLPWQHLLTYCEAVLRVYNRY
GRRDNLYKARIKILVKALSPEKFAQQVEEEWQHLKDGPSTLTEAEVARVEQYFAPPVYEK
LPDTDASFEKHLLESRPFARWVERNVRPHRVSGYASVTISLKPRDIAPGDATDTQMEAVA
DWADQYSLGEIRVSHEQNLILANVKKRDLYALWEQAKAQGFATPNIGLLTDIIACPGGDF
CSLANAKSIPIAQAIQERFDNADFVHDLGDLSLNISGCMNSCGHHHVGNIGVLGVDKDGS
EWYQVSLGGEQGTGVDGAKLGRVIGPSFSAEEMPDVVSKVIDTFVEHRIDGERFIDTYNR
IGIAPFKERVYASRQPAHA
Download sequence
Identical sequences B2JEU5
391038.Bphy_2235 WP_012401616.1.55900 gi|186476986|ref|YP_001858456.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]