SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|186470887|ref|YP_001862205.1| from Burkholderia phymatum STM815

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|186470887|ref|YP_001862205.1|
Domain Number 1 Region: 4-121,218-335,504-562
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 9.27e-44
Family Succinate dehydrogenase/fumarate reductase flavoprotein N-terminal domain 0.035
Further Details:      
 
Domain Number 2 Region: 332-501
Classification Level Classification E-value
Superfamily Succinate dehydrogenase/fumarate reductase flavoprotein, catalytic domain 6.98e-34
Family Succinate dehydrogenase/fumarate reductase flavoprotein, catalytic domain 0.00067
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|186470887|ref|YP_001862205.1|
Sequence length 581
Comment fumarate reductase/succinate dehydrogenase flavoprotein domain-containing protein [Burkholderia phymatum STM815]
Sequence
MKREPILECDVLVLGSGAGGLSAAVTAAAQGLRVIVAEKEDVFGGTTAWSGGWMWIPRNP
LATRAGIREDIDAPRTYLKSELGGQFDADKATALLERGPEMIEFFERHTAMRFIDGNRVP
DFHTTPGAATGGRSVCAMPFDGKELGPLLHKLREPLSVMTIKGMALASGQDLAHFYRATR
SVKSALYVTRRLTAFAWQKLRHGRSMHLVNGNALVARLLKSAADRNVDLRTRAKAIGLLR
DDARVTGARVEIDGVVHEVRASRGVVLACGGFPHDVARRASTFAYTPSGKEHWSPAPRSN
TGDGIRLGESIGGHFNDSLDAPAAWAPVSLVPQRGGDVAFAHLIERAKPGVIAVTRAGQR
FVNEASSYHDFISALLGTTPRGEEVCAWLICDHRFQRRYGLGFSKPVPFPVSSYVNSGYL
KRGATLAELAKVCGIDAQGLENTISAYNTYAKDGFDPQFHKGSTPYNRVQGDATHGPNPC
LAPIESGPFYAVKLLPGSLGTFAGLATDANARVLDRNDHAIAGLYAVGNDSASMMGGCYP
SGGITLGPAMTFGYLAGLSLAGAAHLPTRTGSSSSHQGSMQ
Download sequence
Identical sequences B2JW32
gi|186470887|ref|YP_001862205.1|NC_010625 WP_012405318.1.55900 391038.Bphy_6102 gi|186470887|ref|YP_001862205.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]