SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for jgi|Metbi1|187354|CE98015_188 from Metschnikowia bicuspidata NRRL YB-4993 v1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Metbi1|187354|CE98015_188
Domain Number 1 Region: 58-137
Classification Level Classification E-value
Superfamily MgtE N-terminal domain-like 0.0000484
Family MgtE N-terminal domain-like 0.0075
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) jgi|Metbi1|187354|CE98015_188
Sequence length 159
Sequence
MAEIMTETMAEIMTEIIAGIMTEIISEIISEIIAGIMTEIISEIISEIISEIMAEIISEI
ISEIMAEIMAEIMAEIMTEITPEIMAEIMAEIMAEIMTEIMTEITPEVMAEIMAEIMAEI
MAEIMTEITPEIMAEIMTEIMTQIYIRLWVGFTSVLAED
Download sequence
Identical sequences A0A1A0HBY8
XP_018712036.1.9870 jgi|Metbi1|187354|CE98015_188

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]