SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for jgi|Metbi1|32577|fgenesh1_kg.4_#_359_#_Locus413v1rpkm486.88 from Metschnikowia bicuspidata NRRL YB-4993 v1.0

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  jgi|Metbi1|32577|fgenesh1_kg.4_#_359_#_Locus413v1rpkm486.88
Domain Number - Region: 28-66
Classification Level Classification E-value
Superfamily Frataxin/Nqo15-like 0.0366
Family Frataxin-like 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) jgi|Metbi1|32577|fgenesh1_kg.4_#_359_#_Locus413v1rpkm486.88
Sequence length 68
Sequence
MSEQEQEKIIKTLEEEDEFEDFPEDAQWTSEPNSQLNSANLWEEDWDDDDDNDEFTEKLR
EELKKAQK
Download sequence
Identical sequences A0A1A0H9P3
jgi|Metbi1|32577|fgenesh1_kg.4_#_359_#_Locus413v1rpkm486.88 XP_018711120.1.9870

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]