SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for jgi|Metbi1|209746|CE120407_25293 from Metschnikowia bicuspidata NRRL YB-4993 v1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Metbi1|209746|CE120407_25293
Domain Number 1 Region: 4-290
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like II 4.27e-24
Family Phosphate binding protein-like 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) jgi|Metbi1|209746|CE120407_25293
Sequence length 307
Sequence
MEKLVVAYIPEHFSTPMFLADEKGYYREEGLEIEFFPVIEGSGRLIKLLNDRTVDVAVGL
TEAFVADISKGNKSYSIVGTYVESPLCWAISTGKNRDDIQSAADLAGSRIGVSRIGSGSY
VMSFVLGLQNNFAAPYFSDFKVVHNFQNLRDSVNLKYRSDSGEQVDSEAFMWEHFTSKKY
YDSGEIKRIGEIYTPWPSWVFTANQRVFETRKSNLSGFLRAVKKGVAYFLQNPEEAVDHI
STHLNYSVDDAREWLTTVKFNEEIGVKPIDWHTVVENTAEVLKTAGVIPKDDIVGERLKM
QVVSLVE
Download sequence
Identical sequences jgi|Metbi1|209746|CE120407_25293

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]