SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|170288029|ref|YP_001738267.1| from Thermotoga sp. RQ2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|170288029|ref|YP_001738267.1|
Domain Number 1 Region: 214-317
Classification Level Classification E-value
Superfamily Protein-L-isoaspartyl O-methyltransferase, C-terminal domain 2.48e-66
Family Protein-L-isoaspartyl O-methyltransferase, C-terminal domain 0.000000905
Further Details:      
 
Domain Number 2 Region: 7-180,216-225
Classification Level Classification E-value
Superfamily S-adenosyl-L-methionine-dependent methyltransferases 8.6e-45
Family Protein-L-isoaspartyl O-methyltransferase 0.0000000416
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|170288029|ref|YP_001738267.1|
Sequence length 317
Comment protein-L-isoaspartate O-methyltransferase [Thermotoga sp. RQ2]
Sequence
MREKLFWILKKYGVSDHIAKAFLEIPREEFLTKSYPLSYVYEDIVLVSYDDGEEYSTSSQ
PSLMALFMEWVGLDKGMRVLEIGGGTGYNAAVMSRVVGEKGLVVSVEYSRKICEIAKRNV
ERLGIENVIFVCGDGYYGVPEFSPYDVIFVTVGVDEVPETWFTQLKEGGRVIVPINLKLS
RRQPAFLFKKKDPYLVGNYKLETRFITAGGNLGNLLERNRKLLREFPFNREILLVRSHIF
VELVDLLTRRLTEIDGTFYYAGPNGVVEFLDDRMRIYGDAPEIENLLTQWESCGYRSFEY
LTLHVGYNAFSHISCSI
Download sequence
Identical sequences A0A0F6AJG7
gi|170288029|ref|YP_001738267.1| WP_012310401.1.32102 126740.TRQ2_0224

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]