SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|410663542|ref|YP_006915913.1| from Simiduia agarivorans SA1 = DSM 21679

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|410663542|ref|YP_006915913.1|
Domain Number 1 Region: 4-365
Classification Level Classification E-value
Superfamily FMN-linked oxidoreductases 2.46e-112
Family FMN-linked oxidoreductases 0.0000000013
Further Details:      
 
Domain Number 2 Region: 336-525
Classification Level Classification E-value
Superfamily Nucleotide-binding domain 3.06e-42
Family N-terminal domain of adrenodoxin reductase-like 0.00000713
Further Details:      
 
Domain Number 3 Region: 472-631
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 4.82e-19
Family C-terminal domain of adrenodoxin reductase-like 0.00000642
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|410663542|ref|YP_006915913.1|
Sequence length 673
Comment NADH:flavin oxidoreductase [Simiduia agarivorans SA1 = DSM 21679]
Sequence
MSHPTYPHLLEPLDLGFTQLKNRVLMGSMHTGLEEAPDGFERMAAYFAERARGGVGLMVT
GGFAPNREGATADHAGSLETADDVAKHKIITDAVHEADGKICLQILHTGRYAFSEKLIAP
SAIQAPINFFTPREVTEEDIHKQIDDFARCAKLAQDAGYDGVEVMGSEGYFINQFIVTHT
NKRNDQWGGAYENRMRFAVEVVNAVRERVGPEFIIIYRLSMLDLVEQGSSYEEVVQLGQA
IEKAGATIINTGIGWHEARIPTIATKVPRAAFTWVTAKVRKALSVPVITSNRINTPEVAE
EVLARGDADMISMARPFLADPEFVKKAQENRADEINTCIGCNQACLDHVFSLKLSSCLVN
PRACHETELLILPTEKPKKLAVIGAGPAGLAFATTAAKRGHKVTLFDKASEIGGQFNIAK
RVPGKEEFYETLRYFGKQLALTGVELKLNTEVSRDQLNETDFDEIILATGIVPRTPSIEG
VNHPKVLSYLDVFAGKPVGKKVAIIGAGGIGFDVAEFITHAGKSTSLDIPAFMAEWGVDM
TMTARGGIAGVQPSAHPSDREVWLLQRKATKVGAGLGKTTGWIHRTGLKNKGVNMVPACE
YVKIDDQGLHLQIDGEPQVLPVDNVILCAGQEPQRALVEGLNKTVHLIGGADVAAELDAK
RAIDQGTRLAASL
Download sequence
Identical sequences K4KJK9
WP_015046356.1.44930 WP_015046356.1.62639 gi|410663542|ref|YP_006915913.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]