SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|448821136|ref|YP_007414298.1| from Lactobacillus plantarum ZJ316

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|448821136|ref|YP_007414298.1|
Domain Number 1 Region: 9-269
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 2.7e-83
Family Protein kinases, catalytic subunit 0.00000364
Further Details:      
 
Weak hits

Sequence:  gi|448821136|ref|YP_007414298.1|
Domain Number - Region: 517-578
Classification Level Classification E-value
Superfamily Penicillin-binding protein 2x (pbp-2x), c-terminal domain 0.0262
Family Penicillin-binding protein 2x (pbp-2x), c-terminal domain 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|448821136|ref|YP_007414298.1|
Sequence length 674
Comment Serine/threonine protein kinase [Lactobacillus plantarum ZJ316]
Sequence
MTPNYTLSGRYRIVRSLGEGGMANVYLAHDLILDRDVAVKLLRLDLRDDPKTIKRFQREA
LATTELVHPHIVSLYDIGEENGMQYLVMEYVKGMDLKNYIKENFPLPLQQVIDIMEQILS
AVATAHAHNIIHRDLKPQNILIDEQGNAKITDFGIAVALSEHTMTQTNTILGSVHYLSPE
QARGSMATKQSDIYSLGIILYEMLTGSVPFKGETAVSIALKHFQNAMPSVREFDADIPQA
LENVVLQATTKDPRERYATVEDMATDLLTVLASSRAGEKRFVPQDVGNDETKIMPSADIQ
AAIAANQDGKTQVVAHKSKQPTLQRPAETTESQTDADEEPLPTRSWSKRHPLRRRLLFWG
GIILLLVVAVIVGLELSRPQMTTVPKVTGLSQRAATKVLKKHHLTVGTVQHAKSNQVAKN
QVIKSTPSVKTRVQERARINLVISNGAKVMSFGNYVNDNYHDVRQTLKSAGFKVKETYST
SSVAAGQIISQDVVAGSRVMPTDTTVTFTVSAGSRYVELKDLTGESKSDILDYAEANDLN
VNFKQGYSSEQKAGYSYDQDPDGGGNVRTGSTITVTMSRGSDNNVTTPQNFYVKLTVPYK
ALSATTAQANDVKIYLYDDTHMIETVYRDIAIMRSTKISLPFQLTGNTKGHYRIVRNGVT
IMEKKNITSKNATK
Download sequence
Identical sequences A0A2I0YXU2 M4KH62 R9X3J3
WP_003645152.1.16071 WP_003645152.1.22404 WP_003645152.1.37302 WP_003645152.1.66154 WP_003645152.1.69852 WP_003645152.1.74868 WP_003645152.1.82735 WP_003645152.1.83366 WP_003645152.1.88099 WP_003645152.1.89637 WP_003645152.1.9731 WP_003645152.1.98190 gi|448821136|ref|YP_007414298.1| gi|513841096|ref|YP_008121068.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]