SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|189025606|ref|YP_001933378.1| from Treponema pallidum subsp. pallidum SS14

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|189025606|ref|YP_001933378.1|
Domain Number 1 Region: 30-235
Classification Level Classification E-value
Superfamily Adenine nucleotide alpha hydrolases-like 1.81e-44
Family PP-loop ATPase 0.00049
Further Details:      
 
Domain Number 2 Region: 391-465
Classification Level Classification E-value
Superfamily PheT/TilS domain 0.00000000288
Family tRNA-Ile-lysidine synthetase, TilS, C-terminal domain 0.026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|189025606|ref|YP_001933378.1|
Sequence length 477
Comment hypothetical protein TPASS_0373 [Treponema pallidum subsp. pallidum SS14]
Sequence
MSESRQKLHPLLVHVARSFGHFLVPRKPSCLLVAVSGGADSLALLYAAHELAPDFGVCAC
AVTVDHSLRAQEGALDARFVRALCARFSPPLPCFVQQISAGAVHACAKIRGRGVQDAARA
LRYKVFDHVAARCGAQVVLTAHTRDDQYETLLMRLFQGAAASALQGIRAARGRYVRPLLK
VSRTCVEDFLQTRGVRWREDASNTCRKYVRNRIRHELIPALDAVLAGWRSGLDKTFAGIS
AEHSFCVAALTRWREGCSHAWEPVPRALGTRLRMPRSDFLAAEFILRFFLLQEACVRLGV
SHRVPRGALERCARFDGVRRIHVSGLQLERAGAYVLFSCIHASDTARETKKQDAGSPPSS
EKQGVSAIYVARPGAYPCACGTLLVEVRPAGVFVCCAQDHVGVGPFSFPFYIRTHRTGDT
ISIRGGHKGIRKMFSEWHVPLSDRTVLPMIEQDGVLRALYGAALGYQNRYAERTPHE
Download sequence
Identical sequences A0A0A7X2X0 B2S2X0 H6KV93 O83388 R9UVP7
gi|378973947|ref|YP_005222553.1| gi|378975009|ref|YP_005223617.1| gi|15639364|ref|NP_218813.1| gi|378981856|ref|YP_005230161.1| gi|408502253|ref|YP_006869697.1| 243276.TP0373 455434.TPASS_0373 WP_010881821.1.101681 WP_010881821.1.10609 WP_010881821.1.11013 WP_010881821.1.177 WP_010881821.1.22706 WP_010881821.1.24110 WP_010881821.1.24144 WP_010881821.1.26337 WP_010881821.1.26670 WP_010881821.1.28216 WP_010881821.1.31174 WP_010881821.1.34567 WP_010881821.1.35526 WP_010881821.1.35589 WP_010881821.1.37724 WP_010881821.1.38137 WP_010881821.1.38252 WP_010881821.1.38852 WP_010881821.1.39803 WP_010881821.1.41302 WP_010881821.1.42739 WP_010881821.1.42752 WP_010881821.1.43796 WP_010881821.1.44774 WP_010881821.1.45335 WP_010881821.1.49513 WP_010881821.1.50901 WP_010881821.1.51333 WP_010881821.1.6132 WP_010881821.1.61389 WP_010881821.1.63356 WP_010881821.1.72815 WP_010881821.1.73546 WP_010881821.1.74079 WP_010881821.1.78381 WP_010881821.1.79283 WP_010881821.1.82112 WP_010881821.1.89996 WP_010881821.1.90779 WP_010881821.1.92130 WP_010881821.1.96085 WP_010881821.1.98226 WP_010881821.1.98956 WP_010881821.1.99137 WP_010881821.1.99367 gi|488657794|ref|YP_007936176.1| gi|378972880|ref|YP_005221484.1| gi|189025606|ref|YP_001933378.1| gi|512443844|ref|YP_008119123.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]